4PPZ,3IC1


Conserved Protein Domain Family
dapE_proteo

?
TIGR01246: dapE_proteo 
Click on image for an interactive view with Cn3D
succinyl-diaminopimelate desuccinylase, proteobacterial clade
This model describes a proteobacterial subset of succinyl-diaminopimelate desuccinylases. An experimentally confirmed Gram-positive lineage succinyl-diaminopimelate desuccinylase has been described for Corynebacterium glutamicum (SP:Q59284), and a neighbor-joining tree shows the seed members, SP:Q59284, and putative archaeal members such as TrEMBL:O58003 in a single clade. However, the archaeal members differ substantially, share a number of motifs with acetylornithine deacetylases rather than succinyl-diaminopimelate desuccinylases, and are not taken as trusted examples of succinyl-diaminopimelate desuccinylases. This model is limited to proteobacterial members for this reason. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 162269
View PSSM: TIGR01246
Aligned: 8 rows
Threshold Bit Score: 577.444
Threshold Setting Gi: 488942992
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4PPZ_A         6 SLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGT-----KAPVVCFAGHTDVVPTGPVEKW 80  Neisseria menin...
P44514         5 VVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGT-----SEPVIAFAGHTDVVPTGDENQW 79  Haemophilus inf...
3IC1_A         5 VVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGT-----SEPVIAFAGHTDVVPTGDENQW 79  Haemophilus inf...
WP_010892662   4 VFDLTCDLISRPSVTPEDAGCQAMIAARLERVGFTCEHLHYGSVANLWATHGQ-----GAPVLVLLGHTDVVPPGPIEAW 78  Xylella fastidiosa
WP_010895942   5 ITELAKKLISIPSVSPKDLGCQDIIIKRLCAIGFDIKRVNVNDTKNFWAFRGT-----GK-TLTFAGHTDVVPIGQDKDW 78  Buchnera aphidi...
WP_000132407   6 VLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGT-----QSPLFVFAGHTDVVPAGPLSQW 80  Vibrio cholerae
WP_004596737   2 YTHYLKNLVSFKSVTPNSAGAIEYIDDLLKQHSFKTEIKIFGDSKKEQVTNLYaifggNEPNICFVGHVDVVPAGNYEFW 81  Rickettsia prow...
WP_002854067   3 AKEFLIELLKFKSVTPNDDGALNFIAMELS--DFEAFFIEKEGIKNLLLTKKFk---dEGEHLAFGGHVDVVPAG--EGW 75  Campylobacter j...
4PPZ_A        81 DS-PPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHPNHQG-SIALLITSDEEGDALDGTTKVVDVLKARDELID 158 Neisseria menin...
P44514        80 SS-PPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKG-TIALLITSDEEATAKDGTIHVVETLMARDEKIT 157 Haemophilus inf...
3IC1_A        80 SS-PPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKG-TIALLITSDEEATAKDGTIHVVETLMARDEKIT 157 Haemophilus inf...
WP_010892662  79 TS-DPFIPQRREGKLYGRGAADMKGSVAAFVIAAERFLVAHAGHPG-TLAILLTSDEEGQAIDGVRKVAETLRQRGQGID 156 Xylella fastidiosa
WP_010895942  79 QT-DPFQPVIRSGYLFGRGSADMKGALAAMITAAERFVNKFPNHKG-RLSFLITSDEESSAVDGTIKIVEYLMSKRDMID 156 Buchnera aphidi...
WP_000132407  81 HT-PPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEHPDHQG-SIGFLITSDEEGPFINGTVRVVETLMARNELID 158 Vibrio cholerae
WP_004596737  82 HNsNPFKFHEQDGKIYGRGTVDMKGAIACFLAASLNFIKNNTDFKG-SISFLITSDEEGKSKHGTKEMLQYIYDQRYKID 160 Rickettsia prow...
WP_002854067  76 SN-NAFAPVEKEGFIYARGAQDMKSGVAAFVDAA-----KNADFKGaRLSLILTSDEEGEAIYGTKAVLEWMQERDMLPD 149 Campylobacter j...
4PPZ_A       159 YCIVGEPTAVDKLGDMIKNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNI 238 Neisseria menin...
P44514       158 YCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANI 237 Haemophilus inf...
3IC1_A       158 YCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANI 237 Haemophilus inf...
WP_010892662 157 WCLTGEPSSSKRLGDLLRVGRRGSLSATLHVKGVQGHVAYPHQARNPIHLAVPALAALTARHWDDGDESFPSTSLQISNI 236 Xylella fastidiosa
WP_010895942 157 YCIVGEPSSTNIVGDVIKNGRRGSITANITIYGIQGHIAYPDLADNPIHKGLPVILKILSIKLDSGNDFFLPSSINIANI 236 Buchnera aphidi...
WP_000132407 159 MCIVGEPSSTLAVGDVVKNGRRGSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNL 238 Vibrio cholerae
WP_004596737 161 FAVVGEPTCEKEIGDTIKIGRRGSVNFKLNIVGLAGHVAYPHKANNPLPCLIKILNELINIKLDEGTEFFQNSNLEVTNI 240 Rickettsia prow...
WP_002854067 150 YAVVAEPTCVKKIGDSIKIGRRGSINGKLLIRGKQGHVAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPSKIVITDI 229 Campylobacter j...
4PPZ_A       239 NGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK----HGVQYDLQWSCSGQPFLT--Q-AGKLTDVARAAIA 311 Neisseria menin...
P44514       238 HAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEK----HNLKYRIEWNLSGKPFLT--K-PGKLLDSITSAIE 310 Haemophilus inf...
3IC1_A       238 HAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEK----HNLKYRIEWNLSGKPFLT--K-PGKLLDSITSAIE 310 Haemophilus inf...
WP_010892662 237 HAGTGANNVIPGALEVAFNLRYNPHWSAPRLESEIVALLDQ----HGLDYTLHWHRSGEPFYT--P-EGKLRRIAREVLE 309 Xylella fastidiosa
WP_010895942 237 HAGNGFNNVIPGSLFVQFNIRFSSEVSEKHIQSQIVNILNS----NDINYSIEWLFSGKPFIT--K-KGLLIDTVIQSIF 309 Buchnera aphidi...
WP_000132407 239 QAGTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDA----HGLDYDVKWTLSGQPFLT--D-TGELLAAVVAAVE 311 Vibrio cholerae
WP_004596737 241 DVDNDTSNTIPASAAAHFNIRFNSLHNVETLRQLIEQIIKQyckeYKVDYKLEYSSSAESFIQnpN-DNDKIKKFANVIE 319 Rickettsia prow...
WP_002854067 230 RGGMGVCNVTPNDLKLMFNVRNSPDTSLEDVKSYVEKIC------HGLNYELELKQSSEAFLT--NiDNKIVQKMNESVQ 301 Campylobacter j...
4PPZ_A       312 ETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDIPKLSAVYEGILARL 375 Neisseria meningitidis MC58
P44514       311 ETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNL 374 Haemophilus influenzae Rd KW20
3IC1_A       311 ETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNL 374 Haemophilus influenzae
WP_010892662 310 RFSGAPPEESTGGGTSDARFIAPLGAQCIEIGPVNASIHQVDEHVCLADLEALPDLYQLLIERL 373 Xylella fastidiosa
WP_010895942 310 YFNKKKPILSTSGGTSDGRFIALMGSEVVELGLVNNTIHKVNECVKISDLKLLSCMYEDIMKNL 373 Buchnera aphidicola
WP_000132407 312 EVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADLEKLTDMYQKTLNHL 375 Vibrio cholerae
WP_004596737 320 RTLKIKSKFSTSGGTSDARFVKDY-CSLVEFGLLSDMAHKINEYTKISDLQKLYNVYYNFLIEI 382 Rickettsia prowazekii
WP_002854067 302 KITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIHAIDERVSIEEFEKLCLVFKDLIENF 365 Campylobacter jejuni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap