3QR9


Conserved Protein Domain Family
trpD

?
TIGR01245: trpD 
Click on image for an interactive view with Cn3D
anthranilate phosphoribosyltransferase
In many widely different species, including E. coli, Thermotoga maritima, and Archaeoglobus fulgidus, this enzymatic domain (anthranilate phosphoribosyltransferase) is found C-terminal to glutamine amidotransferase; the fusion protein is designated anthranilate synthase component II (EC 4.1.3.27) [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 273522
View PSSM: TIGR01245
Aligned: 18 rows
Threshold Bit Score: 369.674
Threshold Setting Gi: 10581120
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3QR9_A        30 LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPAdtVPDDAVDVVGTGG 109 Mycobacterium t...
P56737         5 LNALYHQKDLNDEEVKKLFTLIIHEKVSPVQLGAILCALKIKGESFKEISVAATTLLEHAPKPFN--SGLDLIDNCGTGG 82  Helicobacter py...
Q9JQM3         8 IERLISNNELFYDEMTDLMRQIMRGQVLPEQIAAILTGLRIKVETVSEITAAAAVMREFATKVPLe-NAEGLVDIVGTGG 86  Neisseria menin...
O27698         7 ISEIMDFRNLSEDEAYSLMEMIMAGELDDIKIAAILTALAMKGETVDEITGFARAMRDRSPRVRVs-GSHEVVDSCGTGG 85  Methanothermoba...
O66576         8 LRKIAEFENLTAEEMYNLMKEVAEGRATDAQIGALVMGTKMKGETPEEIEGAVKLFREKVVRVPVk-DPEELVDVVGTGG 86  Aquifex aeolicu...
WP_009874234   5 LLKIYDSKFLNQEESYQLFTLISSGKITDIKLASILTAMKIRGESIEEITGAIKAFLDKMKYFPk--PDYIFSDIVGTGG 82  Buchnera aphidi...
AAA22866       5 LQLCVDGKTLTAGEAETLMNMMMAAEMTPSEMGGILSILAHRGETPEELAGFVKAMRAHALTVDGl-P--DIVDTCGTGG 81  Bacillus subtilis
WP_002858662 202 LQKMSENHFLQSDDFEQICKIIMSKDYEILQVVALLILITEKSLNEKSLSAFVRQILRYSQTFSDe-S--EMIDICGTGG 278 Campylobacter j...
WP_010867587   2 LEKIINRENLSFEEAYNLFKELMNE--SDVRIAAYLAAFQTKGYTAEEIAGLAKAMRDYAIKLELg----EVADTAGTGG 75  Pyrococcus abyssi
WP_032083893  63 LEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALVSMKIRGEHPNEIAGAATALLENAAPFPr--PDYLFADIVGTGG 140 Escherichia coli
3QR9_A       110 DGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAA 189 Mycobacterium t...
P56737        83 DGLKTINISTIAALIASSMGLSMAKHGSRSVSSHSGSADLLENLGVNIEMNPTQLENCFKQTHFGFLFAPLYHQSFKKSA 162 Helicobacter py...
Q9JQM3        87 DGAKTFNISTTSMFVAAAAGAKVAKHGGRSVSSSSGAADVVEQMGANLNLTPEQVAQSIRQTGIGFMFAPNHHSAMRHVA 166 Neisseria menin...
O27698        86 DSFRSYNISTAAAMIAAAAGVRVAKHGNRAVTGSCGGADILEAAGVNIELDAAAAARSLSDVGISFMFAPLFHRATARVA 165 Methanothermoba...
O66576        87 DKSSTFNVSTVTGFVLAGAGVKVAKHGNRSVSSKSGSADFLEALGAKVELLPEKVARLIEEVGFGFMFAPLFHPAMKRVV 166 Aquifex aeolicu...
WP_009874234  83 DAKNTINISTMSAFVAATCGLKIIKHCNQRISSKSGSSDILEKFNINLNASPEKSRKTLDQLNICFLFAPKYHDGFKYSN 162 Buchnera aphidi...
AAA22866      82 DGISTFNISTPSAIVASAAGAKIAKHGNRSVSSKSGSADVLEELEVSIQTTPEKVKSSIETNNMGFLFAPLYHSSMKHVA 161 Bacillus subtilis
WP_002858662 279 DGFKSINVSTTSAFILAALGVKVAKHGNRAISSSSGSTDVLEALNITTPNTLESVLKQLNNQGLSFLHAPFFHPLVGELK 358 Campylobacter j...
WP_010867587  76 DGSSSINVSTASALILSA-FTKVAKHGNVSITSKSGSANVLEALGLNIKIPPEKARKMIEKTNFTFIFAPMYHPALKRIM 154 Pyrococcus abyssi
WP_032083893 141 DGSNSINISTASAFVAAACGLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFLFAPKYHTGFRHAM 220 Escherichia coli
3QR9_A       190 AVRREIGVPTVFNLLGPLTNP-ARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGd-----DGLDELTTTTTSTIWR 262 Mycobacterium t...
P56737       163 PLRKELFTKTIFNCLGPLINP-LRPKIQLLGVYDKSLCKTMALALKALGVKrAMVVNG------GGTDEIVLHDITHACE 235 Helicobacter py...
Q9JQM3       167 PVRRSLGFRSIFNILGPLTNP-AGAPNQLLGVFHTDLCGILSRVLQQLGSKhVLVVCGe-----GGLDEITLTGKTRVAE 240 Neisseria menin...
O27698       166 AVRRSLGFKTVFNILGPLTSP-AAAGIQLLGVFDPQLVGPVAEVLRNLGTRcAMVVHGfdanlnPALDEISTVGPTLVAF 244 Methanothermoba...
O66576       167 SPRREVGVRSIFNLIGPLTNP-AGVKRYLLGVFSKEYVDKFAKALKNLGVKkAFVVHGe-----GGIDEVSVEGETYVTE 240 Aquifex aeolicu...
WP_009874234 163 NVRTDLKTKTIFNFLGPFLNP-ATPPLSVIGVYNKNLINIAVNILKNLQYKrAIVLHS------DNTDEVTLYGTTYVSE 235 Buchnera aphidi...
AAA22866     162 GTRKELGFRTVFNLLGPLSNP-LQAKSGDWG-YSVEKAGLMASALETFQPKhVMFVSSr-----DGLDELSITAPTDVIE 234 Bacillus subtilis
WP_002858662 359 EIRSRLGVRTVFNVLGPLLHPnLKLKYQLMGNYHAPVHRLLIEVLKNLGRKkALVVRGn-----DGMDELSICDESKIYE 433 Campylobacter j...
WP_010867587 155 PVRRELKVKTVFNILGPLANP-AEPKFQVLGVNSPDLVEKMAEALSFLGVErALVVHG------MGLDEVNPRGETIVAE 227 Pyrococcus abyssi
WP_032083893 221 PVRQQLKTRTLFNVLGPLINP-AHPPLALIGVYSPELVLPIAETLRVLGYQrAAVVHS------GGMDEVSLHAPTIVAE 293 Escherichia coli
3QR9_A       263 VAAGSVDKLTFDPAGFGFARAQ-LDQLAGGDA-QANAAAVRAVL-GGA----RGPVRDAVVLNAAGAIVAHAGLsSraew 335 Mycobacterium t...
P56737       236 LKNNGILEYDLSAKDFDLPPYD-LKELQIENA-QESTQACLDILeNKG----KDSHTMVVVANVASLLYLSHKAkD---- 305 Helicobacter py...
Q9JQM3       241 LKDGKISEYDIRPEDFGIETRRnLDEIKVANT-QESLLKMNEVLeGRE-----GAARDIVLLNTAAALYAGNVAaS---- 310 Neisseria menin...
O27698       245 LEDDEIRIDRLMPPDFGVEVGE-LEHLRAGSTtAENLELFMDVLrGREdtpeQKSRLDIALANAGALIYLAGLAdT---- 319 Methanothermoba...
O66576       241 VSEEGIRSFTFSPEELGVKRKS-LSEVRVNSP-EESVKVALSVLrGEE----GTP-RDMVLLNASFGILVSERAgD---- 309 Aquifex aeolicu...
WP_009874234 236 LLNKKIISYQLQPESFGLKMHP-KKILKINSL-EENYHIIKEIMkGKG----SKLYEELIAVNVAMLLKVFGYE-N---- 304 Buchnera aphidi...
AAA22866     235 LKDGERREYTVSPEDFGFTNGR-LEDLQVQSP-KESAYLIQNIFeNKS----SSSALSITAFNAGAAIYTAGITaS---- 304 Bacillus subtilis
WP_002858662 434 LCEGEILEYSICPEQFGFKRAF-HSEIIGSSA-YDNAKDLKDILsGRM----QGAKFDLVVLNAMFALYTANKAsS---- 503 Campylobacter j...
WP_010867587 228 VNGEDIDMYTLTPEDFGVER---VKVVPCNSP-QESAERIKAVLrGEG----KVEDRNFILINASAALYASKVAeD---- 295 Pyrococcus abyssi
WP_032083893 294 LHDGEIKSYQLTAEDFGLTPYH-QEQLAGGTP-EENRDILTRLLqGKG----DAAHEAAVAANVAMLMRLHGHE-D---- 362 Escherichia coli
3QR9_A       336 lpaWEEGLRRASAAIDTGAAEQLLARWVRF 365 Mycobacterium tuberculosis
P56737       306 ---LKEGVSMTLEHLKTKAPYAHLQKIIRL 332 Helicobacter pylori 26695
Q9JQM3       311 ---LSDGISAAREAIDSGRAKSKKEEFVGF 337 Neisseria meningitidis serogroup A
O27698       320 ---LPEGTETAKRTVKSGAALELLEEFVSY 346 Methanothermobacter thermautotrophicus str. Delta H
O66576       310 ---IKEAFEMAKESIDSGKALEVLEKYVEL 336 Aquifex aeolicus VF5
WP_009874234 305 ---LKENTKLALNKIRSGDVYKHIRNVANM 331 Buchnera aphidicola
AAA22866     305 ---LKEGTELALETITSGGAAAQLERLKQk 331 Bacillus subtilis
WP_002858662 504 ---PLVAKDMILEAIYSGKVIEYFKEYQAY 530 Campylobacter jejuni
WP_010867587 296 ---FREGVELVKG-ILGEPMSKKLEEIICt 321 Pyrococcus abyssi
WP_032083893 363 ---LQANAQTVLEVLRSGSAYDRVTALAAr 389 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap