2F46


Conserved Protein Domain Family
TIGR01244

?
TIGR01244: TIGR01244 
Click on image for an interactive view with Cn3D
TIGR01244 family protein
No member of this family is characterized. The member from Xylella fastidiosa is a longer protein with an N-terminal region described by this model, followed by a metallo-beta-lactamase family domain and an additional C-terminal region. Members scoring above the trusted cutoff are limited to the proteobacteria. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 130311
View PSSM: TIGR01244
Aligned: 4 rows
Threshold Bit Score: 183.611
Threshold Setting Gi: 2564977
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2F46_A        16 AILKLDEHLYISPQLTKADAEQIAQLGIKTIICNRPDrEEESQPDFAQIKQWLEQAGVTgFHHQPVTARDIQKHDVETFR 95  Neisseria menin...
WP_010981265  15 AILKLDEHLYISPQLTKADAEQIAQLGIKTVICNRPDrEEESQPDFAQIKQWLEQAGVTgFHHQPVTARDIQKHDVETFR 94  Neisseria menin...
WP_010918808   3 DFRFVTESLSVSPQVDPADMARAAAQGFVLVINNRPDgEDPGQPSSASVEAAARAAGMD-YLHVPVR-GGPTPDQVEIMR 80  Caulobacter vib...
AAB82053       2 DLRTLTPDFAVAPQIALDDIAEAARLGFRTLINNRPD-EEVESGLNAALQAAAAAAGLS-YVHLPYYPGELTPDLIAGFE 79  Rhodobacter cap...
2F46_A        96 QLIGQAEYPVLAYCRTGTRCSLLWGFRRAAEgXPVDEIIRRAQAAGVNLENFRERL 151 Neisseria meningitidis Z2491
WP_010981265  95 QLIGQAESPVLAYCRTGTRCSLLWGFRRAAEgMPVDEIIRRAQAAGVNLENFRERL 150 Neisseria meningitidis
WP_010918808  81 AAFEAAGGPVLAFCRSGTRSIVTWSIGQALAgVDRETLVAQGYAAGYDLSGVLPA- 135 Caulobacter vibrioides
AAB82053      80 AALAAADAPVLAWCRSGTRSSHLWALSQAGQ-RPLEEIVQTAQNAGYDLSALVPML 134 Rhodobacter capsulatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap