Conserved Protein Domain Family
26Sp45

?
TIGR01242: 26Sp45 
26S proteasome subunit P45 family
Many proteins may score above the trusted cutoff because an internal
Statistics
?
PSSM-Id: 130309
View PSSM: TIGR01242
Aligned: 5 rows
Threshold Bit Score: 638.383
Threshold Setting Gi: 20532220
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O28303  20 YYKLRELYRRLEDEKKFIESERIRYEREVRRLRSEVERLRSPPLLVGVVSDILEDGRVVVKSSTGPKFVVNTSQYINEEE 99  Archaeoglobus fulgidu...
Q58576  49 IAELESRILKLELEKKELERENLQLMKENEILRRELDRMRVPPLIVGTVVDKVGERKVVVKSSTGPSFLVNVSHFVNPDD 128 Methanocaldococcus ja...
O57940  19 ITYLKRRIRQLELQVRMLEADKERLERELSRLRSEMSRLRQPPAFAGTVIEVLDEDRAIVQNYNGPRFVVRIAPWIDRKK 98  Pyrococcus horikoshii...
O26824  30 KRNLMWKIRKLEKDKLLIENERTRLDREVKSLRGEIERFRTPPLVIATVTEVLDDHRVAVKSTTGPHFVINYSRFIDRKQ 109 Methanothermobacter t...
Q9YAC7  18 HSERDVEIRILKDKVRSLTKEKISLQKELEYYKNEITKLLSPPYIEAVVLEVIDDNRVVVKSSTGPNLIVNVAAGVDARS 97  Aeropyrum pernix K1
O28303 100 LKPGARVALNQQTLAIVNVLPTSKDPMVYGFEVEEKPEVSYEDIGGLDVQIEEIREAVELPLLKPELFAEVGIEPPKGVL 179 Archaeoglobus fulgidu...
Q58576 129 LAPGKRVCLNQQTLTVVDVLPENKDYRAKAMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGIL 208 Methanocaldococcus ja...
O57940  99 LRPGTRVALDQRTMAVVEILPTSKDPTVLGFEVIERPNVTYNDIGGLKKQLQELREAIELPLKHPELFEEVGIDPPKGVL 178 Pyrococcus horikoshii...
O26824 110 LEPGARVALNQQTFSIVDVLPSEKDPVVTGMEVEEKPDVSYEQIGGLEEQVREVKETVELPLKKPELFEKIGIEPPKGVL 189 Methanothermobacter t...
Q9YAC7  98 LKPGAIVALNNRGSTIVDVLPGRYDPLVKAMEVEERPKVFFKDVGGLEEQIREIYEAVVLPIKNPHLFRELGIDPPKGVL 177 Aeropyrum pernix K1
O28303 180 LYGPPGTGKTLLAKAVANQTRATFIRVVGSEFVQKYIGEGARLVREVFQLAKEKAPSIIFIDELDAIAARRTNSDTSGDR 259 Archaeoglobus fulgidu...
Q58576 209 LYGPPGTGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDR 288 Methanocaldococcus ja...
O57940 179 LYGPPGCGKTLMAKALAHEVNATFIRVVGSELVRKYIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRMDETTGGER 258 Pyrococcus horikoshii...
O26824 190 LYGPPGTGKTLLAKAVAHETNATFIKIVASEFVRKYIGEGARLVRGVFELAKEKSPSIIFIDEIDAVAAKRLKSSTSGDR 269 Methanothermobacter t...
Q9YAC7 178 LHGPPGTGKTLLAKAVAGETEATFIRVVGSELVNKFIGEGARLVREIFRLAREKAPSILFIDEIDAIASKRVDIGTSGDR 257 Aeropyrum pernix K1
O28303 260 EVQRTMMQLLAELDGFDPRGDVKVIGATNRIDILDPAILRPGRFDRIIEVPLPTFEGRIQIFKIHTRKMKLAEDVDFKEL 339 Archaeoglobus fulgidu...
Q58576 289 EVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEI 368 Methanocaldococcus ja...
O57940 259 EVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFEGRLEILKVHTRRMKLKG-VDLRAI 337 Pyrococcus horikoshii...
O26824 270 EVQRTLMQLLAELDGFESRGNVGIVAATNRPDILDPALLRPGRFDRFIEVPLPNEDGRREILKIHTSGMALAEEVDIELL 349 Methanothermobacter t...
Q9YAC7 258 EVQRTMLQLLAELDGFDPLDNVKVIAATNRLDLIDPAVLRPGRFDRIIEVPLPSLRGRLEILGIHTRKAKMAPDVDLEAI 337 Aeropyrum pernix K1
O28303 340 ARITEGASGADIKAICTEAGMFAIREERAKVTMLDFTKAIEKVL 383 Archaeoglobus fulgidus DSM 4304
Q58576 369 AKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIM 412 Methanocaldococcus jannaschii DSM 2661
O57940 338 AEMTEGASGADLKAIATEAGMFAIRERRTYVTQEDFLKAVDKVL 381 Pyrococcus horikoshii OT3
O26824 350 ARITDGASGADLKAICTEAGMFAIRDERDEVTMADFMDAVDKIM 393 Methanothermobacter thermautotrophicus str. Delta H
Q9YAC7 338 AKLTEGFSGADLKAVVVEAGYNAIRRGSRVITMDDMIKAVEKVK 381 Aeropyrum pernix K1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap