Conserved Protein Domain Family

TIGR01238: D1pyr5carbox3 
delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain)
This model represents one of several related branches of delta-1-pyrroline-5-carboxylate dehydrogenase. Members of this branch are the C-terminal domain of the PutA bifunctional proline dehydrogenase / delta-1-pyrroline-5-carboxylate dehydrogenase. [Energy metabolism, Amino acids and amines]
PSSM-Id: 273518
Aligned: 3 rows
Threshold Bit Score: 873.851
Threshold Setting Gi: 597944062
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
EYC49099  816 NCYINRDQVGAVVGVQPFGGQGLSGTGPKAGGPHYLYRFTQVQY 859  Vibrio cholerae O1 biovar El Tor str. L-3226
EYC49099  816 NCYINRDQVGAVVGVQPFGGQGLSGTGPKAGGPHYLYRFTQVQY 859  Vibrio cholerae O1 biovar El Tor str. L-3226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap