Conserved Protein Domain Family
D1pyr5carbox3

?
TIGR01238: D1pyr5carbox3 
delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain)
This model represents one of several related branches of delta-1-pyrroline-5-carboxylate dehydrogenase. Members of this branch are the C-terminal domain of the PutA bifunctional proline dehydrogenase / delta-1-pyrroline-5-carboxylate dehydrogenase. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 273518
View PSSM: TIGR01238
Aligned: 3 rows
Threshold Bit Score: 873.851
Threshold Setting Gi: 597944062
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O52485    610 DLYGSGRSNSAGLDLANEHRLASLSSSLLNSALHKWQALPML--EQP-----VAEGEMQPVVNPAEPKDIVGYVREASDA 682  Enterobacter aero...
CAM09185  587 DLYGKCRLNSQGVDLSNENVLQQLQEQMNKAAAQDFHAASIVn-GKA-----RDVGEAQPIKNPADHDDIVGTVSFADAA 660  Neisseria meningi...
EYC49099  346 EIFAE-RKNSLGINIDIESEAKPFEAQIHAWLDKTWQAAPIIggHSYyesmiKADHSAEPVTAPYDRRIQIGQVFHANLD 424  Vibrio cholerae O...
O52485    683 EVQQALTSAINNAPIWFATPPQERAAILERAAVLMESQMPTLMGILVREAGKTFSNAIAEVREAVDFLHYYAGQVRDDFD 762  Enterobacter aero...
CAM09185  661 LAQEAVGAAVAAFPEWSATPAAERAACLRRFADLLEQHTPALMMLAVREAGKTLNNAIAEVREAVDFCRYYANEAEHTLP 740  Neisseria meningi...
EYC49099  425 HVSAAIDSAQQAFATWNALDAKERASKLDALADLLELHMPELVALCHQEAGKTIHDSIDEVREAVDFCRYYGKQV-DVLG 503  Vibrio cholerae O...
O52485    763 NEtHRP------------LGPVVCISPWNFPLAIFTGQIAAALAAGNSVLAKPAEQTPLIAAQGVAILLEAGVPPGVIQL 830  Enterobacter aero...
CAM09185  741 QD-AKA------------VGAIVAISPWNFPLAIFTGEVVSALAAGNTVIAKPAEQTSLIAGYAVSLMHEAGIPTSALQL 807  Neisseria meningi...
EYC49099  504 EFsVESfdgstrrvsrqgRGVFVCISPWNFPLAIFLGQISAALVAGNTVIAKPAEQTSLIAYRAVELMQEAGFPAGTIQL 583  Vibrio cholerae O...
O52485    831 LPGRGeTVGAALTSDERVRGVMFTGSTEVATLLQRNIASRLDPQGrptpLIAETGGMNAMIVDSSALTEQVVIDVLASAF 910  Enterobacter aero...
CAM09185  808 VLGAG-DVGAALTNDARIGGVIFTGSTEVARLINKALAKRGDNPV----LIAETGGQNAMIVDSTALAEQVCADVLNSAF 882  Neisseria meningi...
EYC49099  584 LPGRGaDIGSALTSHPAIAGVAFTGSTATAQRINQTLAQREAAPVp---FIAETGGQNAMIVDSTALPEQVVRDVLRSAF 660  Vibrio cholerae O...
O52485    911 DSAGQRCSALRVLCLQEEVADHTLTMLRGAMSECRMGNPGRLTTDIGPVIDAEAKENIERHIQAMRAKGRTVYQAVRENS 990  Enterobacter aero...
CAM09185  883 DSAGQRCSALRILCVQEDVADRMLDMIKGAMDELVVGKPIQLTTDVGPVIDAEAQQNLLNHINKMKGVAKSYHEVKTAAD 962  Neisseria meningi...
EYC49099  661 ASAGQRCSALRVLFVQQDIADRVITLIQGAMQELKVSVPHLHQTDVGPVIDEKAKQKLLAHIEHMSQTQKKIAQLTLDD- 739  Vibrio cholerae O...
O52485    991 edaREWRHGTFVPPTLIELDSFDELKKEVFGPVLHVVRYNRNELDKLVEQINASGYGLTLGVHTRIDETIAQVTGSAKVG 1070 Enterobacter aero...
CAM09185  963 ---VDSEKSTFVRPILFELNNLNELQREVFGPVLHVVRYRADKLDSVIDQINSKGYALTHGVHSRIEGTVRHIRSRIEAG 1039 Neisseria meningi...
EYC49099  740 ----ACQHGDFVAPTAFEIDDIAALSEEQFGPILHIVRFKARELAQIVDKINQTGFGLTMGIHSRNETTYRWIEKHARVG 815  Vibrio cholerae O...
O52485   1071 NLYVNRNMVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLSSRP 1114 Enterobacter aerogenes
CAM09185 1040 NVYVNRNIVGAVVGVQPFGGHGLSGTGPKAGGSFYLQKLTRIPE 1083 Neisseria meningitidis Z2491
EYC49099  816 NCYINRDQVGAVVGVQPFGGQGLSGTGPKAGGPHYLYRFTQVQY 859  Vibrio cholerae O1 biovar El Tor str. L-3226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap