3V9G,4OE4


Conserved Protein Domain Family
D1pyr5carbox1

?
TIGR01236: D1pyr5carbox1 
Click on image for an interactive view with Cn3D
delta-1-pyrroline-5-carboxylate dehydrogenase, group 1
This model represents one of two related branches of delta-1-pyrroline-5-carboxylate dehydrogenase. The two branches are not as closely related to each other as some aldehyde dehydrogenases are to this branch, and separate models are built for this reason. The enzyme is the second of two in the degradation of proline to glutamate. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 273517
Aligned: 7 rows
Threshold Bit Score: 957.313
Threshold Setting Gi: 685918931
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3V9G_A        36 ANEPVLAFTQGS-PERDALQKaLKDLKGRMEAIPCVVGDEEVWTSDv---QYQVSPFNHGHKVAKFCYADKSLLNKAIEA 111 human
AAF31034      19 LNEPMDNFEPGSvSAKGTLEA-CKEARGEVRECPIMIGGKPYTSSNi---IKATMPSDHQVQIAKAYNATPELAKKAVEA 94  Leishmania major
P30038        33 ANEPVLAFTQGS-PERDALQKaLKDLKGRMEAIPCVVGDEEVWTSDv---QYQVSPFNHGHKVAKFCYADKSLLNKAIEA 108 human
WP_010865988  10 KNEPFLEFRPGT-KERELLKKkLEEVKSKTVEIPLIIGGKEV-KTGe--tVEIRAPHDKDAVLAVAHLAGEEEIRDAIEK 85  Aeropyrum pernix
P07275        29 RNEPVKPFRNIDlKDWDLLRAsLMKFKSSSLEVPLVINGERIYDNNeralFPQTNPANHQQVLANVTQATEKDVMNAVKA 108 Saccharomyces c...
4OE4_A        28 RNEPVKPFRNIDlKDWDLLRAsLMKFKSSSLEVPLVINGERIYDNNeralFPQTNPANHQQVLANVTQATEKDVMNAVKA 107 Saccharomyces c...
WP_031655631  11 ANEPVHDYAPKS-PERTRLRTeLASLADHPIDLPHVIGGRHRMGDGe--rIDVVQPHRHAARLGTLTNATHADAAAAVEA 87  Mycobacterium t...
AAF31034      19 LNEPMDNFEPGSvSAKGTLEA-CKEARGEVRECPIMIGGKPYTSSNi---IKATMPSDHQVQIAKAYNATPELAKKAVEA 94  Leishmania major
P30038        33 ANEPVLAFTQGS-PERDALQKaLKDLKGRMEAIPCVVGDEEVWTSDv---QYQVSPFNHGHKVAKFCYADKSLLNKAIEA 108 human
WP_010865988  10 KNEPFLEFRPGT-KERELLKKkLEEVKSKTVEIPLIIGGKEV-KTGe--tVEIRAPHDKDAVLAVAHLAGEEEIRDAIEK 85  Aeropyrum pernix
P07275        29 RNEPVKPFRNIDlKDWDLLRAsLMKFKSSSLEVPLVINGERIYDNNeralFPQTNPANHQQVLANVTQATEKDVMNAVKA 108 Saccharomyces c...
4OE4_A        28 RNEPVKPFRNIDlKDWDLLRAsLMKFKSSSLEVPLVINGERIYDNNeralFPQTNPANHQQVLANVTQATEKDVMNAVKA 107 Saccharomyces c...
WP_031655631  11 ANEPVHDYAPKS-PERTRLRTeLASLADHPIDLPHVIGGRHRMGDGe--rIDVVQPHRHAARLGTLTNATHADAAAAVEA 87  Mycobacterium t...
3V9G_A       112 ALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQP--I 189 human
AAF31034      95 AVEASKEWSQVPFRDRAAIFYKAAHLLSTKYRHEMRAVTMLGQSKNPWQAEIDCVAEACDFIRWNIHFAEELYAQQPrsV 174 Leishmania major
P30038       109 ALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPi-- 186 human
WP_010865988  86 ALDAWTKWSEMEWYHRASVFLKAADLLAGPYRLEADAVIMLNHSKTPWEAEID-LAELVDFWRFGAYYARFIFEQQP--E 162 Aeropyrum pernix
P07275       109 AKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPv-E 187 Saccharomyces c...
4OE4_A       108 AKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPv-E 186 Saccharomyces c...
WP_031655631  88 AMSAKSDWAALPFDERAAVFLRAADLLAGPWREKIAAATMLGQSKSVYQAEIDAVCELIDFWRFNVAFARQILEQQP--I 165 Mycobacterium t...
AAF31034      95 AVEASKEWSQVPFRDRAAIFYKAAHLLSTKYRHEMRAVTMLGQSKNPWQAEIDCVAEACDFIRWNIHFAEELYAQQPrsV 174 Leishmania major
P30038       109 ALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPi-- 186 human
WP_010865988  86 ALDAWTKWSEMEWYHRASVFLKAADLLAGPYRLEADAVIMLNHSKTPWEAEID-LAELVDFWRFGAYYARFIFEQQP--E 162 Aeropyrum pernix
P07275       109 AKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPv-E 187 Saccharomyces c...
4OE4_A       108 AKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPv-E 186 Saccharomyces c...
WP_031655631  88 AMSAKSDWAALPFDERAAVFLRAADLLAGPWREKIAAATMLGQSKSVYQAEIDAVCELIDFWRFNVAFARQILEQQP--I 165 Mycobacterium t...
3V9G_A       190 SVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADG 269 human
AAF31034     175 SNSGVWNTTDYRPLEGFVSAITPFNFTAIAANLAGTPALMGNTVVWKPSPTAVLSNYLMYKIMEEAGLPAGVINFVPCEP 254 Leishmania major
P30038       187 sVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADG 266 human
WP_010865988 163 QAPGELNRVEWRPLEGFVFAVPPFNFFSIGGNLPTAPALVGNVSIWKPSRWVIYSNYIIMRILMEAGLPPGVVNFVPFN- 241 Aeropyrum pernix
P07275       188 SADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINFIPGDP 267 Saccharomyces c...
4OE4_A       187 SADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINFIPGDP 266 Saccharomyces c...
WP_031655631 166 SGPGEWNRIDYRPLDGFVYAITPFNFTSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDG 245 Mycobacterium t...
AAF31034     175 SNSGVWNTTDYRPLEGFVSAITPFNFTAIAANLAGTPALMGNTVVWKPSPTAVLSNYLMYKIMEEAGLPAGVINFVPCEP 254 Leishmania major
P30038       187 sVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADG 266 human
WP_010865988 163 QAPGELNRVEWRPLEGFVFAVPPFNFFSIGGNLPTAPALVGNVSIWKPSRWVIYSNYIIMRILMEAGLPPGVVNFVPFN- 241 Aeropyrum pernix
P07275       188 SADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINFIPGDP 267 Saccharomyces c...
4OE4_A       187 SADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINFIPGDP 266 Saccharomyces c...
WP_031655631 166 SGPGEWNRIDYRPLDGFVYAITPFNFTSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDG 245 Mycobacterium t...
3V9G_A       270 PLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNL--DR--FHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFE 345 human
AAF31034     255 AVMDSAVNADPRLAAVVFTGSTRVFTEINKNVFSRL--ET--YHNFPRISGETGGKDFHLVHPSADVRHVAAGTVRGAFE 330 Leishmania major
P30038       267 PLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNL--DR--FHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFE 342 human
WP_010865988 242 TKYSSIVLSHPDFAGLHFTGSYSTFVRLWKMIAQNL--DK--YRNFPRIVGETGGKDFIVVHPSADITEAVVATIRGAFE 317 Aeropyrum pernix
P07275       268 VQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGV--VEgkYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFE 345 Saccharomyces c...
4OE4_A       267 VQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVveGK--YRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFE 344 Saccharomyces c...
WP_031655631 246 FAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GR--YHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFD 321 Mycobacterium t...
AAF31034     255 AVMDSAVNADPRLAAVVFTGSTRVFTEINKNVFSRL--ET--YHNFPRISGETGGKDFHLVHPSADVRHVAAGTVRGAFE 330 Leishmania major
P30038       267 PLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNL--DR--FHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFE 342 human
WP_010865988 242 TKYSSIVLSHPDFAGLHFTGSYSTFVRLWKMIAQNL--DK--YRNFPRIVGETGGKDFIVVHPSADITEAVVATIRGAFE 317 Aeropyrum pernix
P07275       268 VQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGV--VEgkYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFE 345 Saccharomyces c...
4OE4_A       267 VQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVveGK--YRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFE 344 Saccharomyces c...
WP_031655631 246 FAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNI--GR--YHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFD 321 Mycobacterium t...
3V9G_A       346 YGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPa--------EDFGTFFSAVIDAKSFARIKKWLEHARSSPs-L 416 human
AAF31034     331 FQGQKCSACSRLYAPQSCWKELKALLIKGQKQVKMGQP---------DDFQSFMCAVIDETSFNKNKKYIEIAKADSsnY 401 Leishmania major
P30038       343 YGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPa--------EDFGTFFSAVIDAKSFARIKKWLEHARSSPs-L 413 human
WP_010865988 318 YQGQKCSAASRLFVPKSMWPRFWEAMKAELDKVKVGPV---------DDFTVFMGAIISEEQFRKIVSYIEYAKQHPeeY 388 Aeropyrum pernix
P07275       346 FQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMntsaspisgGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPe-L 424 Saccharomyces c...
4OE4_A       345 FQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMntsaspisgGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPe-L 423 Saccharomyces c...
WP_031655631 322 YQGQKCSAVSRAFIAHSVWQRMGDELLAKAAELRYGDI---------TDLSNYGGALIDQRAFVKNVDAIERAKG-AaaV 391 Mycobacterium t...
AAF31034     331 FQGQKCSACSRLYAPQSCWKELKALLIKGQKQVKMGQP---------DDFQSFMCAVIDETSFNKNKKYIEIAKADSsnY 401 Leishmania major
P30038       343 YGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPa--------EDFGTFFSAVIDAKSFARIKKWLEHARSSPs-L 413 human
WP_010865988 318 YQGQKCSAASRLFVPKSMWPRFWEAMKAELDKVKVGPV---------DDFTVFMGAIISEEQFRKIVSYIEYAKQHPeeY 388 Aeropyrum pernix
P07275       346 FQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMntsaspisgGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPe-L 424 Saccharomyces c...
4OE4_A       345 FQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMntsaspisgGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPe-L 423 Saccharomyces c...
WP_031655631 322 YQGQKCSAVSRAFIAHSVWQRMGDELLAKAAELRYGDI---------TDLSNYGGALIDQRAFVKNVDAIERAKG-AaaV 391 Mycobacterium t...
3V9G_A       417 TILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDD---KYKETLQLVDSTTSYGLTGAVFSQDKDVV 493 human
AAF31034     402 EIVAGGKCDKTRGYFVEPTIIETKDPRAQLMREEIFGPVLTVFVYDDSkpgYWKEVCELVDSTTKYGLTGAVFSRERAPI 481 Leishmania major
P30038       414 TILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDD---KYKETLQLVDSTTSYGLTGAVFSQDKDVV 490 human
WP_010865988 389 QIIYGGKYDDSKGYFIWPTVVLTNNPKGKLMTEEIFGPVLTVYVYDDD---KYDEILWVVDKAAPYGLTGSVFAKDREAI 465 Aeropyrum pernix
P07275       425 EILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDT---EFNEICDIIDNTSQYALTGAIFAKDRKAI 501 Saccharomyces c...
4OE4_A       424 EILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDT---EFNEICDIIDNTSQYALTGAIFAKDRKAI 500 Saccharomyces c...
WP_031655631 392 TVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDE---RYEQILDVIDTGSRYALTGAVIADDRQAV 468 Mycobacterium t...
AAF31034     402 EIVAGGKCDKTRGYFVEPTIIETKDPRAQLMREEIFGPVLTVFVYDDSkpgYWKEVCELVDSTTKYGLTGAVFSRERAPI 481 Leishmania major
P30038       414 TILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDD---KYKETLQLVDSTTSYGLTGAVFSQDKDVV 490 human
WP_010865988 389 QIIYGGKYDDSKGYFIWPTVVLTNNPKGKLMTEEIFGPVLTVYVYDDD---KYDEILWVVDKAAPYGLTGSVFAKDREAI 465 Aeropyrum pernix
P07275       425 EILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDT---EFNEICDIIDNTSQYALTGAIFAKDRKAI 501 Saccharomyces c...
4OE4_A       424 EILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDT---EFNEICDIIDNTSQYALTGAIFAKDRKAI 500 Saccharomyces c...
WP_031655631 392 TVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDE---RYEQILDVIDTGSRYALTGAVIADDRQAV 468 Mycobacterium t...
3V9G_A       494 QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 566 human
AAF31034     482 READKYLRYAAGNYYVNDKCTGAVVGQQPFGGSRLSGSNDKPGAGQFVTRFVSARSIKESFDVTPTISYPHQL 554 Leishmania major
P30038       491 QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 563 human
WP_010865988 466 LKAEKALRYAAGNFYINDKPTGSIVARQPFGGARWSGTNDKAGWFTNLLRWLNPRSIKETLVPPKEWRRPYMG 538 Aeropyrum pernix
P07275       502 EYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKENFYELTDFKYPSNY 574 Saccharomyces cerevisi...
4OE4_A       501 EYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKENFYELTDFKYPSNY 573 Saccharomyces cerevisi...
WP_031655631 469 LTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSGTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMA 541 Mycobacterium tubercul...
AAF31034     482 READKYLRYAAGNYYVNDKCTGAVVGQQPFGGSRLSGSNDKPGAGQFVTRFVSARSIKESFDVTPTISYPHQL 554 Leishmania major
P30038       491 QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 563 human
WP_010865988 466 LKAEKALRYAAGNFYINDKPTGSIVARQPFGGARWSGTNDKAGWFTNLLRWLNPRSIKETLVPPKEWRRPYMG 538 Aeropyrum pernix
P07275       502 EYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKENFYELTDFKYPSNY 574 Saccharomyces cerevisi...
4OE4_A       501 EYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKENFYELTDFKYPSNY 573 Saccharomyces cerevisi...
WP_031655631 469 LTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSGTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMA 541 Mycobacterium tubercul...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap