2QF7


Conserved Protein Domain Family
pyruv_carbox

?
TIGR01235: pyruv_carbox 
Click on image for an interactive view with Cn3D
pyruvate carboxylase
This enzyme plays a role in gluconeogensis but not glycolysis. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 130302
View PSSM: TIGR01235
Aligned: 5 rows
Threshold Bit Score: 2097.16
Threshold Setting Gi: 1709946
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QF7_A         16 KILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLALHRFKADESYQVGRGphlardLGPIESYLSIDEVIRVAKLSGAD 95   Rhizobium etl...
P11154         21 KILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVg----qYTPVGAYLAIDEIISIAQKHQVD 96   Saccharomyces...
AAC44388        5 KILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLALHRFKADESYQVGRGphlardLGPIESYLSIDEVIRVAKLSGAD 84   Rhizobium etli
WP_003244778    8 KVLVANRGEIAIRIFRACTELNIRTVAVYSKEDSGSYHRYKADEAYLVGEG------KKPIDAYLDIEGIIDIAKRNKVD 81   Bacillus subt...
AAB64306       40 SVLVANRGEIAIRVFRACNELGIRSVAVYSEQDKMHMHRQKADESYMVGKG------LAPVEAYLSIPEIIRVCKENDVD 113  yellow fever ...
2QF7_A         96 AIHPGYGLLSESPEFVDACNKAGIIFIGPKADTMRQLGNKVAARNLAISVGVPVVPATEPLPDDMAEVAKMAAAIGYPVM 175  Rhizobium etl...
P11154         97 FIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVI 176  Saccharomyces...
AAC44388       85 AIHPGYGLLSESPEFVDACNKAGIIFIGPKADTMRQLGNKVAARNLAISVGVPVVPATEPLPDDMAEVAKMAAAIGYPVM 164  Rhizobium etli
WP_003244778   82 AIHPGYGFLSENIHFARRCEEEGIVFIGPKSEHLDMFGDKVKAREQAEKAGIPVIPGSDGPAETLEAVEQFGQANGYPII 161  Bacillus subt...
AAB64306      114 AVHPGYGFLSERSDFAQAVIDAGLRFIGPSPKVVQQMGDKVAARKAAIEAGVPIVPGTDGPVTTKEEALDFCKKHGLPVI 193  yellow fever ...
2QF7_A        176 LKASWGGGGRGMRVIRSEADLAKEVTEAKREAMAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSVQRRNQ 255  Rhizobium etl...
P11154        177 IKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ 256  Saccharomyces...
AAC44388      165 LKASWGGGGRGMRVIRSEADLAKEVTEAKREAMAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSVQRRNQ 244  Rhizobium etli
WP_003244778  162 IKASLGGGGRGMRIVRSESEVKEAYERAKSEAKAAFGNDEVYVEKLIENPKHIEVQVIGDKQGNVVHLFERDCSVQRRHQ 241  Bacillus subt...
AAB64306      194 FKAAYGGGGRGMRVVRKMEEVEDNFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQ 273  yellow fever ...
2QF7_A        256 KVVERAPAPYLSEAQRQELAAYSLKIAGATNYIGAGTVEYLMDADtG-KFYFIEVNPRIQVEHTVTEVVTGIDIVKAQIH 334  Rhizobium etl...
P11154        257 KVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-N-RHYFIEINPRIQVEHTITEEITGIDIVAAQIQ 334  Saccharomyces...
AAC44388      245 KVVERAPAPYLSEAQRQELAAYSLKIAGATNYIGAGTVEYLMDAD-TgKFYFIEVNPRIQVEHTVTEVVTGIDIVKAQIH 323  Rhizobium etli
WP_003244778  242 KVIEVAPSVSLSPELRDQICEAAVALAKNVNYINAGTVEFLVANN---EFYFIEVNPRVQVEHTITEMITGVDIVQTQIL 318  Bacillus subt...
AAB64306      274 KVVEIAPAPRLPREVRDKMTEYAVKLAKHVGYENAGTVEFLCDES-G-NFYFIEVNARLQVEHTVTEEITGIDLVQSQIR 351  yellow fever ...
2QF7_A        335 ILDGAAIGtpQSGVPnQEDIRLNGHALQCRVTTEDPEHNFIPDYGRITAYRSASGFGIRLDGGTSYSGAIITRYYDPLLV 414  Rhizobium etl...
P11154        335 IAAGASLP--QLGLF-QDKITTRGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLV 411  Saccharomyces...
AAC44388      324 ILDGAAIGtpQSGVPnQEDIRLNGHALQCRVTTEDPEHNFIPDYGRITAYRSASGFGIRLDGGTSYSGAIITRYYDPLLV 403  Rhizobium etli
WP_003244778  319 VAQGHSLHskKVNIPeQKDIFTIGYAIQSRVTTEDPQNDFMPDTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLV 398  Bacillus subt...
AAB64306      352 VAEGMTLP--ELGYN-QENIKTQGYAIQCRVTTEDPANDFQPSTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLV 428  yellow fever ...
2QF7_A        415 KVTAWAPNPLEAISRMDRALREFRIRGVATNLTFLEAIIGHPKFRDNSYTTRFIDTTPELFQQVKRQDRATKLLTYLADV 494  Rhizobium etl...
P11154        412 KCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKLLHYLADV 491  Saccharomyces...
AAC44388      404 KVTAWAPNPLEAISRMDRALREFRIRGVATNLTFLEAIIGHPKFRDNSYTTRFIDTTPELFQQVKRQDRATKLLTYLADV 483  Rhizobium etli
WP_003244778  399 KLSTWALTFEQAAAKMVRNLQEFRIRGIKTNIPFLENVAKHEKFLTGQYDTSFIDTTPELFNFPKQKDRGTKMLTYIGNV 478  Bacillus subt...
AAB64306      429 KVISHASDLQSSAAKMNRALREFRIRGVKTNIPFLLNVLENQKFLNGVLDTYFIDEHPQLFRFAKSKNRAQKLLNYLGEV 508  yellow fever ...
2QF7_A        495 TVNG-HPEAKDRPKPLENAARPVVPYANGNGV--------------KDGTKQLLDTLGPKKFGEWMRNEKRVLLTDTTMR 559  Rhizobium etl...
P11154        492 AVNGsSIKGQIGLPKLKSNPSVPHLHDAQGNVinvt------ksapPSGWRQVLLEKGPAEFARQVRQFNGTLLMDTTWR 565  Saccharomyces...
AAC44388      484 TVNG-HPEAKDRPKPLENAARPVVPYANGNGV--------------KDGTKQLLDTLGPKKFGEWMRNEKRVLLTDTTMR 548  Rhizobium etli
WP_003244778  479 TVNG-FPGIGKKEKPAFDKPLGVKVDVDQQP---------------ARGTKQILDEKGAEGLANWVKEQKSVLLTDTTFR 542  Bacillus subt...
AAB64306      509 LVNGpTTPLATKLKPAEVQPHVPQLPLDLSPEalaaeekgkkvtepPRGFKDILREQGPEGFAKAVRAQKNLLLMDTTFR 588  yellow fever ...
2QF7_A        560 DGHQSLLATRMRTYDIARIAGTYSHALPNLLSLECWGGATFDVSMRFLTEDPWERLALIREGAPNLLLQMLLRGANGVGY 639  Rhizobium etl...
P11154        566 DAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAY 645  Saccharomyces...
AAC44388      549 DGHQSLLATRMRTYDIARIAGTYSHALPNLLSLECWGGATFDVSMRFLTEDPWERLALIREGAPNLLLQMLLRGANGVGY 628  Rhizobium etli
WP_003244778  543 DAHQSLLATRIRSHDLKKIANPTAALWPELFSMEMWGGATFDVAYRFLKEDPWKRLEDLRKEVPNTLFQMLLRSSNAVGY 622  Bacillus subt...
AAB64306      589 DAHQSLLATRVRTHDLLKISPYVSHKFNNLYSLENWGGATFDVALRFLHECPWERLEDMRKQIPNIPFQMLLRGANAVGY 668  yellow fever ...
2QF7_A        640 TNYPDNVVKYFVRQAAKGGIDLFRVFDCLNWVENMRVSMDAIAEENKLCEAAICYTGDILNSARpKYDLKYYTNLAVELE 719  Rhizobium etl...
P11154        646 SSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGK-KYNLDYYLEIAEKIV 724  Saccharomyces...
AAC44388      629 TNYPDNVVKYFVRQAAKGGIDLFRVFDCLNWVENMRVSMDAIAEENKLCEAAICYTGDILNSARpKYDLKYYTNLAVELE 708  Rhizobium etli
WP_003244778  623 TNYPDNVIKEFVKQSAQSGIDVFRIFDSLNWVKGMTLAIDAVRDTGKVAEAAICYTGDILDKNRtKYDLAYYTSMAKELE 702  Bacillus subt...
AAB64306      669 TNYPDNVVHKFCELSVQCGMDIFRVFDSLNYLPNLILGMEAAGNAGGVVEAAISYTGDVSDPTKkKYDLKYYTNLADELV 748  yellow fever ...
2QF7_A        720 KAGAHIIAVXDMAGLLKPAAAKVLFKALREAT-GLPIHFHTHDTSGIAAATVLAAVEAGVDAVDAAMDALSGNTSQPCLG 798  Rhizobium etl...
P11154        725 QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYpDLPIHVHTHDSAGTAVASMTACALAGADVVDVAINSMSGLTSQPSIN 804  Saccharomyces...
AAC44388      709 KAGAHIIAVKDMAGLLKPAAAKVLFKALREAT-GLPIHFHTHDTSGIAAATVLAAVEAGVDAVDAAMDALSGNTSQPCLG 787  Rhizobium etli
WP_003244778  703 AAGAHILGIKDMAGLLKPQAAYELVSALKETI-DIPVHLHTHDTSGNGIYMYAKAVEAGVDIIDVAVSSMAGLTSQPSAS 781  Bacillus subt...
AAB64306      749 KAGTHILCIKDMAGLLKPQAAKLLIAAIREKHpDVPIHIHTHDTSGAGVASMLACAEAGADVVDVAVDSMSGMTSQPSMG 828  yellow fever ...
2QF7_A        799 SIVEALSGsERDPGLDPAWIRRISFYWEAVRNQYAAFES--DLKGPASEVYLHEMPGGQFTNLKEQARSLGLETRWHQVA 876  Rhizobium etl...
P11154        805 ALLASLEG-NIDTGINVEHVRELDAYWAEMRLLYSCFEA--DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETK 881  Saccharomyces...
AAC44388      788 SIVEALSGsERDPGLDPAWIRRISFYWEAVRNQYAAFES--DLKGPASEVYLHEMPGGQFTNLKEQARSLGLETRWHQVA 865  Rhizobium etli
WP_003244778  782 GFYHAMEGnDRRPEMNVQGVELLSQYWESVRKYYSEFES--GMKSPHTEIYEHEMPGGQYSNLQQQAKGVGLGDRWNEVK 859  Bacillus subt...
AAB64306      829 AVVASLQGtPLDTGLNLRDISEYSAYWEQTRTLYAPFECttTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGDFFEDVK 908  yellow fever ...
2QF7_A        877 QAYADANQMFGDIVKVTPSSKVVGDMALMMVSQDLTVADVVSPDREVSFPESVVSMLKGDLGQPPSGWPEALQKKALKG- 955  Rhizobium etl...
P11154        882 RAYREANYLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNk 961  Saccharomyces...
AAC44388      866 QAYADANQMFGDIVKVTPSSKVVGDMALMMVSQDLTVADVVSPDREVSFPESVVSMLKGDLGQPPSGWPEALQKKALKG- 944  Rhizobium etli
WP_003244778  860 EMYRRVNDMFGDIVKVTPSSKVVGDMALYMVQNNLTEKDVYEKGESLDFPDSVVELFKGNIGQPHGGFPEKLQKLILKG- 938  Bacillus subt...
AAB64306      909 KAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNHLTADQVMERAEELSFPKSVIEFLQGAIGTPHGGFPEPFRSRVLKD- 987  yellow fever ...
2QF7_A        956 EKPYTVRPGSLLKEADLDAERKVIEKKLeREVSDFEFASYLMYPKVFTDFALASDTYGPVSVLPTPAYFYGLADGEELFA 1035 Rhizobium etl...
P11154        962 RRKLTCRPGLELEPFDLEKIREDLQNRF-GDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLPTRSFLSPLETDEEIEV 1040 Saccharomyces...
AAC44388      945 EKPYTVRPGSLLKEADLDAERKVIEKKLeREVSDFEFASYLMYPKVFTDFALASDTYGPVSVLPTPAYFYGLADGEELFA 1024 Rhizobium etli
WP_003244778  939 QEPITVRPGELLEPVSFEAIKQEFKEQHnLEISDQDAVAYALYPKVFTDYVKTTESYGDISVLDTPTFFYGMTLGEEIEV 1018 Bacillus subt...
AAB64306      988 MPRIEGRPGASLNPLDFDKLKKDLQESH-PDVSDRDVMSAALYPQVTNDYLNFRDSFGPVDKLDTRVFLTGPKVGEEFEV 1066 yellow fever ...
2QF7_A       1036 DIEKGKTLVIVNQAVS-ATDSQGMVTVFFELNGQPRRIKVPDRAHGATgAAVRRKAEPGNAAHVGAPMPGVISRVFVSSG 1114 Rhizobium etl...
P11154       1041 VIEQGKTLIIKLQAVGdLNKKTGEREVYFDLNGEMRKIRVADRSQKVE-TVTKSKADMHDPLHIGAPMAGVIVEVKVHKG 1119 Saccharomyces...
AAC44388     1025 DIEKGKTLVIVNQAVS-ATDSQGMVTVFFELNGQPRRIKVPDRAHGATgAAVRRKAEPGNAAHVGAPMPGVISRVFVSSG 1103 Rhizobium etli
WP_003244778 1019 EIERGKTLIVKLISIG-EPQPDATRVVYFELNGQPREVVIKDESIKSS-VQERLKADRTNPSHIAASMPGTVIKVLAEAG 1096 Bacillus subt...
AAB64306     1067 TIEKGKTLGFKTLAMAeDLTSNGEREVFFELNGQLRSVMVRDKEAVKE-LHIHPKATKGNKDQVGAPMPGSVIEIKVKVG 1145 yellow fever ...
2QF7_A       1115 QAVNAGDVLVSIEAMKMETAIHAEKDGTIAEVLVKAGDQIDAKDLLAVYG 1164 Rhizobium etli CFN 42
P11154       1120 SLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGENVDSSDLLVLLE 1169 Saccharomyces cerevisiae S288c
AAC44388     1104 QAVNAGDVLVSIEAMKMETAIHAEKDGTIAEVLVKAGDQIDAKDLLAVYG 1153 Rhizobium etli
WP_003244778 1097 TKVNKGDHLMINEAMKMETTVQAPFSGTIKQVHVKNGEPIQTGDLLLEIE 1146 Bacillus subtilis
AAB64306     1146 DRVEKGQPLVVLSAMKMEMVVQSPRAGVVKSLDISSGMKLEGEDLILTLE 1195 yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap