Conserved Protein Domain Family
L-ribulokinase

?
TIGR01234: L-ribulokinase 
ribulokinase
This enzyme catalyzes the second step in arabinose catabolism. The most closely related protein subfamily outside the scope of this model includes ribitol kinase from E. coli. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130301
View PSSM: TIGR01234
Aligned: 3 rows
Threshold Bit Score: 880.798
Threshold Setting Gi: 693229201
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P94524         2 AYTIGVDFGTLSGRAVLVHVQTGEELAAAVKEYRHAVIDTVLP-KTGQKLPRDWALQHPADYLEVLETTIPSLLEQTGVD 80  Bacillus subtil...
BAA92524       8 KYVIGVDFGTLSGRALVVRVADGAEMGSAEHTYRHGVVTEALPgHPEVRLPADYALQVPADYIDVLRFAIPEAVANAGID 87  Mycobacterium s...
WP_032342407   2 AIAIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCD----A--PNNQFRHHPRDYIESMEAALKTVLAELSVE 75  Escherichia coli
P94524        81 P-KDIIGIGIDFTACTILPIDSSGQPLCMLPEYEEEPHSYVKLWKHHAAQKHADRLNQIAEEEGEAFLQRYG-GKISSEW 158 Bacillus subtil...
BAA92524      88 P-ADVVGLGTDFTACTMVAATSDGTPLCQLDEFADRPHAYAKLWRHHAAQPQADRINALAAARGETWLPRYG-GLISSEW 165 Mycobacterium s...
WP_032342407  76 QrAAVVGIGVDSTGSTPAPIDADGNVLALRPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIgGIYSSEW 155 Escherichia coli
P94524       159 MIPKVMQIAEEAPHIYEAADRIIEAADWIVYQLCG-----SLKRSNCTAGYKAMWSEKAg-YPSDDFFEKLNPSMKTITK 232 Bacillus subtil...
BAA92524     166 EFAKGLQILEEDPEIYAAIDRWVEGADWIVWQLTG-----RYVRNISTAGYKAIRQDGK--YPSRAFLAELNPGFASFVE 238 Mycobacterium s...
WP_032342407 156 FWAKILHVTRQDSAVAQSAASWIELCDWVPALLSGttrpqDIRRGRCSAGHKSLWHESWggLPPASFFDELDPILNRHLP 235 Escherichia coli
P94524       233 DKLSGSIHSVGEKAGSLTEKMAKLTGLLPGTAVAVANVDAHVSVPAVGITEPGKMLMIMGTSTCHVLLGEEV----HIVP 308 Bacillus subtil...
BAA92524     239 DKIEQPIGRLGEAAGTLTAQAAAWTGLPEGIVVAVGNIDAHVTAAAADAADPGRLIAIMGTSTCHVMNGRFL----REVP 314 Mycobacterium s...
WP_032342407 236 SPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVGAG-AQPNALVKVIGTSTCDILIADKQsvgeRAVK 314 Escherichia coli
P94524       309 GMCGVVDNGILPGYAGYEAGQSCVGDHFDWFVKTC---------VPPAYQEEAKEKNIGVHELLSEKANHQAPGESGLLA 379 Bacillus subtil...
BAA92524     315 GMCGVVDGGITDGLWGYEAGQSGVGDIFAWFTKNC---------VPKEIAIEASRRGLTLHEHLSELAAEQEVGEHGLVA 385 Mycobacterium s...
WP_032342407 315 GICGQVDGSVVPGFIGLEAGQSAFGDIYAWFGRVLgwpleqlaaQHPELKTQINASQKQLLPALTEAWAKNPSLDHLPVV 394 Escherichia coli
P94524       380 LDWWNGNRSTLVDADLTGMLLGMTLLTKPEEIYRALVEATAYGTRMIIETFKESGVPIEELFAAGGIaEKNPFVMQIYAD 459 Bacillus subtil...
BAA92524     386 LDWHSGNRSVLVDHHLSGIMVGQTLDTTCVDQYRALLEATAFGTRMIVETFQRSGVPVEELVVAGGL-IKNPLLMQIYAD 464 Mycobacterium s...
WP_032342407 395 LDWFNGRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMALGGIaRKNQVIMQACCD 474 Escherichia coli
P94524       460 VTNMDIKISGSPQAPALGSAIFGALAAGkekgGYDDIKKAAANMGKLKDITYTPNAENAAVYEKLYAEYKELVHYFGK-E 538 Bacillus subtil...
BAA92524     465 VTGLPLSCVTSTQAPALGAAIHAAAAAG----EYRDVPTASARMGGRTKNAFTPIPENVTRYNALYAAYVELHDWFGR-N 539 Mycobacterium s...
WP_032342407 475 VLNRPLQIVASDQCCALGAAIFAAVAAK----VHADIPSAQQKMASAVEKTLQPCSEQAQRFEQLYRRYQQWAMSAEQhY 550 Escherichia coli
P94524       539 NHV 541 Bacillus subtilis subsp. subtilis str. 168
BAA92524     540 NPL 542 Mycobacterium smegmatis
WP_032342407 551 LPT 553 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap