3KAO


Conserved Protein Domain Family
lacD

?
TIGR01232: lacD 
Click on image for an interactive view with Cn3D
tagatose 1,6-diphosphate aldolase
This family consists of Gram-positive proteins. Tagatose 1,6-diphosphate aldolase is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130299
View PSSM: TIGR01232
Aligned: 3 rows
Threshold Bit Score: 689.866
Threshold Setting Gi: 125924
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KAO_A   5 SKSNQKIASIEQLSNNEGIISALAFDQRGALKRXXAKHQTEEPTVAQIEQLKVLVAEELTQYASSILLDPEYGLPASDAR 84  Staphylococcus aureus...
P26593   2 VLTEQKRKSLEKLSDKNGFISALAFDQRGALKRLMAQYQDTEPTVAQMEELKVLVADELTKYASSMLLDPEYGLPATKAL 81  Lactococcus lactis su...
P11100   2 SKSNQKIASIEQLSNNEGIISALAFDQRGALKRMMAKHQTEEPTVAQIEQLKVLVAEELTQYASSILLDPEYGLPASDAR 81  Staphylococcus aureus...
3KAO_A  85 NKDCGLLLAYEKTGYDVNAKGRLPDCLVEWSAKRLKEQGANAVKFLLYYDVDDAEEINIQKKAYIERIGSECVAEDIPFF 164 Staphylococcus aureus...
P26593  82 DKEAGLLLAFEKTGYDTSSTKRLPDCLDVWSAKRIKEQGADAVKFLLYYDVDSSDELNQQKQAYIERVGSECVAEDIPFF 161 Lactococcus lactis su...
P11100  82 NKDCGLLLAYEKTGYDVNAKGRLPDCLVEWSAKRLKEQGANAVKFLLYYDVDDAEEINIQKKAYIERIGSECVAEDIPFF 161 Staphylococcus aureus...
3KAO_A 165 LEVLTYDDNIPDNGSVEFAKVKPRKVNEAXKLFSEPRFNVDVLKVEVPVNXKYVEGFAEGEVVYTKEEAAQHFKDQDAAT 244 Staphylococcus aureus...
P26593 162 LEILAYDEEISDAGSVEYAKVKPRKVIEAMKVFSDPRFNIDVLKVEVPVNVKYVEGFADGEVVYSKAEAADFFKAQEEAT 241 Lactococcus lactis su...
P11100 162 LEVLTYDDNIPDNGSVEFAKVKPRKVNEAMKLFSEPRFNVDVLKVEVPVNMKYVEGFAEGEVVYTKEEAAQHFKDQDAAT 241 Staphylococcus aureus...
3KAO_A 245 HLPYIYLSAGVSAELFQETLKFAHEAGAKFNGVLCGRATWSGAVQVYIEQGEDAAREWLRTTGFKNIDDLNKVLKDTATS 324 Staphylococcus aureus...
P26593 242 NLPYIYLSAGVSAKLFQETLQFAHDSGAKFNGVLCGRATWAGSVEPYIKEGEKAAREWLRTTGFENIDELNKVLVKTASP 321 Lactococcus lactis su...
P11100 242 HLPYIYLSAGVSAELFQETLKFAHEAGAKFNGVLCGRATWSGAVQVYIEQGEDAAREWLRTTGFKNIDDLNKVLKDTATS 321 Staphylococcus aureus...
3KAO_A 325 WKQRK 329 Staphylococcus aureus subsp. aureus Mu50
P26593 322 WTDKV 326 Lactococcus lactis subsp. lactis
P11100 322 WKQRK 326 Staphylococcus aureus subsp. aureus Mu50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap