1UWL,2FKN


Conserved Protein Domain Family
hutU

?
TIGR01228: hutU 
Click on image for an interactive view with Cn3D
urocanate hydratase
This model represents the second of four enzymes involved in the degradation of histidine to glutamate. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130295
View PSSM: TIGR01228
Aligned: 7 rows
Threshold Bit Score: 1026.7
Threshold Setting Gi: 499205333
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UWL_A        10 VEIR-APRGNKLTAKSWLTEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWECYDKIVETLTRLEDDETLLVQSGKP 88  Pseudomonas putida
P25080        10 VEIR-APRGNKLTAKSWLTEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWECYDKIVETLTRLEDDETLLVQSGKP 88  Pseudomonas putida
Q9RZ02         7 RTVR-APRGPHKTAKGWIQEAAKRMLMNNLDPEVAEHPESLVVYGGRGKAARNWEAFDHIVATLDRLENDETLLVQSGKP 85  Deinococcus rad...
CAC11384      61 REIH-APRGKTLNTKGWGQEAALRLLMNNLDPMVAKDPANLIVYGGKGKAARNWEAFDKIVQELKRLENDETLLIQSGKP 139 Thermoplasma ac...
WP_010902873  18 QAYRgAPTGTDIECEGWRQEAALRMLNNNLDPEVAEDPENLVVYGGTGQAARSWDAYDAILDELRTLADAETLLVQSGKP 97  Halobacterium s...
P25503         6 KSIR-ANRGTELECLGWEQEAVLRMLRNNLDPEVAEKPEDLIVYGGIGKAARDWDAFHAIEHSLKTLKNDETLLVQSGKP 84  Bacillus subtil...
2FKN_A         6 KSIR-ANRGTELECLGWEQEAVLRMLRNNLDPEVAEKPEDLIVYGGIGKAARDWDAFHAIEHSLKTLKNDETLLVQSGKP 84  Bacillus subtil...
1UWL_A        89 VGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHYGG--SLK 166 Pseudomonas putida
P25080        89 VGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHYGG--TVK 166 Pseudomonas putida
Q9RZ02        86 VAVLRTHEWAPRVLIANSNLVPHWANWETFDKLDQAGLMMYGQMTAGSWIYIGTQGILQGTYETFAGAAQKHFGG--SLK 163 Deinococcus rad...
CAC11384     140 VGVFKTTKDAPRVLIVNAQIVPHWATDDVFWDLEARGLTMFGQMTAGSWIYIGTQGVLQGTYETLSALARKEFGKd-DLS 218 Thermoplasma ac...
WP_010902873  98 VGVFETHERAPSVLIANSNLVGNWADWEQFHELEAEGKIMYGQMTAGSWAYIGTQGIIQGTFETLAELARDHYPDndGLR 177 Halobacterium s...
P25503        85 VGMFRTHPQAPRVLLANSVLVPKWADWEHFHELEKKGLMMYGQMTAGSWIYIGSQGILQGTYETFAELARQHFGG--SLK 162 Bacillus subtil...
2FKN_A        85 VGMFRTHPQAPRVLLANSVLVPKWADWEHFHELEKKGLMMYGQMTAGSWIYIGSQGILQGTYETFAELARQHFGG--SLK 162 Bacillus subtil...
1UWL_A       167 GKWVLTAGLGGMGGAQPLAATLAGACSLNIESQQSRIDFRLETRYVDEQATDLDDALVRIAKYTAEGKAISIALHGNAAE 246 Pseudomonas putida
P25080       167 AKWVLTAGLGGMGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQATDLDDALVRIAKYTAEGKAISIALHGNAAE 246 Pseudomonas putida
Q9RZ02       164 GTITVTAGLGGMGGAQPLAVKLAGGVSITIEIDPTRIRKRLETRYLDEVADNLQDAIARAEGYKAQGVARSIGVQGNAAE 243 Deinococcus rad...
CAC11384     219 GKWVLTSGLGEMGGAQPLAITMNNASGIVVEVDEEKIKRRLRDKYLDTWTESLDEALKMKDESLAEGKPTSIGLLGNAAT 298 Thermoplasma ac...
WP_010902873 178 GKIVATAGLGGMGGAQPLAVTMNHGVCIAAEVDEARIDRRIETGYCMERTDDLGEAIERATAAAEAGDPYSVGVHGNAAD 257 Halobacterium s...
P25503       163 GTLTLTAGLGGMGGAQPLSVTMNEGVVIAVEVDEKRIDKRIETKYCDRKTASIEEALAWAEEAKLAGKPLSIALLGNAAE 242 Bacillus subtil...
2FKN_A       163 GTLTLTAGLGGMGGAQPLSVTMNEGVVIAVEVDEKRIDKRIETKYCDRKTASIEEALAWAEEAKLAGKPLSIALLGNAAE 242 Bacillus subtil...
1UWL_A       247 ILPELVKRGVRPDMVTDQTSAHDPLNGYLPAGWTWEQYRDRAQTEPAAVVKAAKQSMAVHVQAMLDFQKQGVPTFDYGNN 326 Pseudomonas putida
P25080       247 ILPELVKRGVRPDMVTDQTSAHDPLNGYLPAGWTWEQYRDRAQTEPAAVVKAAKQSMAVHVQAMLDFQKQGVPTFDYGNN 326 Pseudomonas putida
Q9RZ02       244 LVPQLVEMNWTPDLLTDQTSAHDPMWGYIPPVNADEDAGKLRSEHAEEYRQRAYAAMAAHVRAMLELQKRGAVTFDYGNN 323 Deinococcus rad...
CAC11384     299 VYDELMRRGIVPDVVSDQTAAHDLNLGYIPEGYTVESAAKFRDENREEYIKRVYASIVKEARAILWFQRHGSKTFDYGNN 378 Thermoplasma ac...
WP_010902873 258 VLEGMLDRDFVPDVVTDQTSAHDELAGYYPSGYTVADADELRDEDPDAYREASMDTMARHVAAVLAMQDAGAVAFEYGNN 337 Halobacterium s...
P25503       243 VHHTLLNRGVKIDIVTDQTSAHDPLIGYVPEGYSLDEADRLRQDTPELYVRLAKQSMKKHVEAMLAFQQKGSIVFDYGNN 322 Bacillus subtil...
2FKN_A       243 VHHTLLNRGVKIDIVTDQTSAHDPLIGYVPEGYSLDEADRLRQDTPELYVRLAKQSMKKHVEAMLAFQQKGSIVFDYGNN 322 Bacillus subtil...
1UWL_A       327 IR-QMAKEEG--------VANAFDFPGFVPAYIRPLFCRGVGPFRWAALSGEAEDIYKTDAKVKELIPDDAHLHRWLDMA 397 Pseudomonas putida
P25080       327 IR-QMAKEEG--------VANAFDFPGFVPAYIRPLFCRGVGPFRWAALSGEAEDIYKTDAKVKELIPDDAHLHRWLDMA 397 Pseudomonas putida
Q9RZ02       324 LR-QRAFEAG--------VEDAFSYPGFVPAFIRDSFCEGRGPFRWVALSGDPQDIYATDKALLELFPEDERLQSWLTYA 394 Deinococcus rad...
CAC11384     379 FR-TRAQEGG--------MKDAFEIPGYVPAYIRDLFAVGSGPFRWVALSGDPQDIYRIDDAIIKNFQKDQHLVRWIKLA 449 Thermoplasma ac...
WP_010902873 338 IRgQVAAHRGdvtttageSHDPFDFPGFVPAYIRPLFCRGKGPFRWVALSGNPADIHRTDRAVTELFPEKDDLHRWIDLA 417 Halobacterium s...
P25503       323 IR-QVAKDEG--------LENAFDFPGFVPAYIRPLFCEGKGPFRWAALSGDPADIYRTDALLKELFPTNKALHRWIDMA 393 Bacillus subtil...
2FKN_A       323 IR-QVAKDEG--------LENAFDFPGFVPAYIRPLFCEGKGPFRWAALSGDPADIYRTDALLKELFPTNKALHRWIDMA 393 Bacillus subtil...
1UWL_A       398 RERISFQGLPARICWVGLG-------LRAKLGLAFNEMVRSGELSAPVVIGRDHLDSGSVSSPNRETEAMRDGSDAVSDW 470 Pseudomonas putida
P25080       398 RERISFQGLPARICWVGLG-------LRAKLGLAFNEMVRSGELSAPVVIGRDHLDSGSVSSPNRETEAMRDGSDAVSDW 470 Pseudomonas putida
Q9RZ02       395 ADQIAFQGLPARICWLGYK-------ERDRAAKLFNDMVKDGRVKAPIVIGRDHLDAGSVASPYRETEAMKDGSDAVSDW 467 Deinococcus rad...
CAC11384     450 KERVHFQGLPARICYASYG-------EREEIGLMINDMVRSGDLQAPVAIGRDHHDTGSVASPYRETEKMKDGSDAIADW 522 Thermoplasma ac...
WP_010902873 418 QEHVQFQGLPSRVCWLGYCaadddltERARFAVRINELVDNGEIEAPIVVTRDHLDAGSVASPNRETEAMRDGTDAVADW 497 Halobacterium s...
P25503       394 QEKVTFQGLPSRICWLGYG-------ERKKMGLAINELVRTGELKAPVVIGRDHLDCGSVASPNRETEAMKDGSDAVGDW 466 Bacillus subtil...
2FKN_A       394 QEKVTFQGLPSRICWLGYG-------ERKKMGLAINELVRTGELKAPVVIGRDHLDCGSVASPNRETEAMKDGSDAVGDW 466 Bacillus subtil...
1UWL_A       471 PLLNALLNTAGGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAAERIARVLTNDPGTGVMRHADAGYDIAIDCAKE-QG 549 Pseudomonas putida
P25080       471 PLLNALLNTAGGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAAERIARVLTNDPGTGVMRHADAGYDIAIDCAKE-QG 549 Pseudomonas putida
Q9RZ02       468 PLLNFGVGIASGASWMSFHHGGGVGLGFSQHSGLVIVADGTDEAAKKLSRALTNDPGMGVIRHADAGYDHALDVARE-RG 546 Deinococcus rad...
CAC11384     523 PILNALLNAISGATWVSVHHGGGTAIGNAIHAGFVIVADGTKDAEERIKRVLNADPGIGVIRHADAGYESSIDIIKKgPK 602 Thermoplasma ac...
WP_010902873 498 PILNALLNTAAGADIVSVHNGGGVGIGNSLHTNNHVVLDGSDAAAETARRVFTTDPGMGVIRHADAGYADALVEADA-SG 576 Halobacterium s...
P25503       467 AVLNALVNTAAGASWVSFHHGGGVGMGYSLHAGMVAVADGSELADERLARVLTSDPGMGIIRHADAGYERAVEVAKE-QD 545 Bacillus subtil...
2FKN_A       467 AVLNALVNTAAGASWVSFHHGGGVGMGYSLHAGMVAVADGSELADERLARVLTSDPGMGIIRHADAGYERAVEVAKE-QD 545 Bacillus subtil...
1UWL_A       550 LDLPM 554 Pseudomonas putida
P25080       550 LDLPM 554 Pseudomonas putida
Q9RZ02       547 IDLPS 551 Deinococcus radiodurans R1
CAC11384     603 FRYPY 607 Thermoplasma acidophilum
WP_010902873 577 VTVPM 581 Halobacterium salinarum
P25503       546 IIVPM 550 Bacillus subtilis subsp. subtilis str. 168
2FKN_A       546 IIVPM 550 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap