1W27


Conserved Protein Domain Family
phe_am_lyase

?
TIGR01226: phe_am_lyase 
Click on image for an interactive view with Cn3D
phenylalanine ammonia-lyase
Members of this subfamily of MIO prosthetic group enzymes are phenylalanine ammonia-lyases. They are found, so far, in plants and fungi. From phenylalanine, this enzyme yields cinnaminic acid, a precursor of many important plant compounds. This protein shows extensive homology to histidine ammonia-lyase, the first enzyme of a histidine degradation pathway. Note that members of this family from plant species that synthesize taxol are actually phenylalanine aminomutase, and are covered by exception model TIGR04473.
Statistics
?
PSSM-Id: 130293
View PSSM: TIGR01226
Aligned: 7 rows
Threshold Bit Score: 993.924
Threshold Setting Gi: 4127289
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W27_A    26 DPLYWGIAAEAMTGSHLDEVKKMVAEYR-KPVVKLGGETLTISQVAAISARdgsG----VTV-ELSEAAR--AGVKASSD 97  parsley
O23865    19 DPLNWGMAAEALTGSHLDEVKRMVAEFR-KPMVQLGGETLTVSQVAAIAAG---S----VKV-ELAESAR--AGVKASSD 87  carrot
P52777    30 DPLNWVRAAKAMEGSHFEEVKAMVDSYFgAKEISIEGKSLTISDVAAVARRs--Q----VKV-KLDAAAAk-SRVEESSN 101 loblolly pine
P10248    34 KTAGAGSLLPTTETTQLDIVERILADAGaTDQIKLDGYTLTLGDVVGAARR---G----RSV-KVADSPHirEKIDASVE 105 Rhodotorula mucilag...
CAA61198  23 DPLNWGKATEEMTGSQVDEVKRIGAEYR-QPLVKIEGASLRIAQVAAVAAA---G----EARvELDESAR--ERVKASSD 92  long-grained rice
CAA34226  11 DPLNWGAAAAEMAGSHLDEVKRMVAQFR-EPLVKIQGATLRVGQVAAVAQA---KdaarVAV-ELDEEAR--PRVKASSE 83  Japanese rice
CAA09013  36 LSKASRTMTKTSALSQFLEAYRELEGYKnGRAIKVDGQTLSIAAVAAAARY---N----AAV-ELDESPLvkERVRKSQL 107 fly agaric
1W27_A    98 WVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG----------SDN--TLPHSATRAAMLVRIN 165 parsley
O23865    88 WVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG----------NDSsnILPHSATRAAMLVRIN 157 carrot
P52777   102 WVLTQMTKGTDTYGVTTGFGATSHRRTNQGAELQKELIRFLNAGVLGKC----------PEN--VLSEDTTRAAMLVRTN 169 loblolly pine
P10248   106 FLRTQLDN--SVYGVTTGFGGSADTRTEDAISLQKALLEHQLCGVLPTSmdgf---algRGLenSLPLEVVRGAMTIRVN 180 Rhodotorula mucilag...
CAA61198  93 WVMNSMMNGTDSYGVTTGFGATSHRRTKEGGALQRELIRFLNAGAFGTG----------TDGh-VLPAEATRAAMLVRIN 161 long-grained rice
CAA34226  84 WILTCIAHGGDIYGVTTGFGGTSHRRTKDGPALQVELLRYLNAGIFGTG----------SDGh-TLPSETVRAAMLVRIN 152 Japanese rice
CAA09013 108 AIANKVSTGASVYGLSTGFGGSADTRTDKPMLLGFALLQHQHVGILPTStepldvlplqDANntSMPEAWIRGAILIRMN 187 fly agaric
1W27_A   166 TLLQGYSGIRFEILEAITKFLNQNITPCLPLRGTITX--DLVPLSYIAGLLTGRPNSKAVGPTG-----VILSPEEAFKL 238 parsley
O23865   158 TLLQGYSGIRFEILEAITKFLNQNITPCLPLRGTITAsgDLVPLSYIAGLLTGRPNSKAVGPTG-----ENLTAAEAFKL 232 carrot
P52777   170 TLLQGYSGVRWDILETVEKLLNAWLTPKLPLRGTITAsgDLVPLSYIAGLLTGRPNSRVRSRDG-----IEMSGAEALKK 244 loblolly pine
P10248   181 SLTRGHSAVRIVVLEALTNFLNHGITPIVPLRGTISAsgDLSPLSYIAASITGHPDSKVHVDG------KIMSAQEAIAL 254 Rhodotorula mucilag...
CAA61198 162 TLLQGYSGIRFEILEAIAKLLNANVTPCLPLRGTITAsgDLVPLSYIAGLVTGRENAWALPPDG-----SKVNAAEGLKI 236 long-grained rice
CAA34226 153 TLLQGYSGIRFEILEAITKLLNTGVTPCLPLRGTITAsgDLVPLSYIAGLITGRPNAQAISPDG-----RKVDAAEAFKL 227 Japanese rice
CAA09013 188 SLIRGHSGIRWELIEKMRELLAANVIPVVPLRGSISSsgDLSPLSYIAGTIIGNPSIKVYHGPSksgirQIGSSKDVLAL 267 fly agaric
1W27_A   239 AGVEGg-FfELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPE-FTDHLTHKLKHHPGQIEAA 316 parsley
O23865   233 AGVDGgfF-ELQPKEGLALVNGTAVGSGMASMVLFETNILAVLAEVMSAIFAEVMQGKPE-FTDHLTHKLKHHPGQIEAA 310 carrot
P52777   245 VGLEKp-F-ELQPKEGLAIVNGTSVGAALASIVCFDANVLALLSEVISAMFCEVMNGKPE-FTDPLTHKLKHHPGQMEAA 321 loblolly pine
P10248   255 KGLQP--V-VLGPKEGLGLVNGTAVSASMATLALTDAHVLSLLAQALTALTVEAMVGHAGsFHPFLHDVTRPHPTQIEVA 331 Rhodotorula mucilag...
CAA61198 237 AGIQGg-FfELQPKEGLAMVNGTAVGSGLASTVLFEANILAILAEVLSAVFCEVMNGKPE-YTDHLTHKLKHHPGQIEAA 314 long-grained rice
CAA34226 228 AGIEGg-FfTLNPKEGLAIVNGTSVGSALAATVMFDANILAVLSEVLSAVFCEVMNGKPE-YTDHLTHKLKHHPGSIDAA 305 Japanese rice
CAA09013 268 HNIEP--F-PLESKEPLGILNGTAFSASVAALALNEAIHLVLLAQVCTAMGTEALIGTRAsHAPFIHATARPHPGQVECA 344 fly agaric
1W27_A   317 AIMEHILDGSAYVKAAQKLHEMDPLQ-KPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREIN--SVNDNPLIDVSRNKAI 393 parsley
O23865   311 AIMEHILDGSSYVKAAEKQHEMDPLQ-KPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREIN--SVNDNPLIDVSRNKAI 387 carrot
P52777   322 AIMEYVLDGSSYMKHAAKLHEMNPLQ-KPKQDRYGLRTSPQWLGPQVEIIRSATHMIEREIN--SVNDNPVIDVARDKAL 398 loblolly pine
P10248   332 RNIRTLLEGSKYAVHHETEVKVKDDEgILRQDRYPLRCSPQWLGPLVSDMIHAHAVLSLEAGq-STTDNPLIDLENKMTH 410 Rhodotorula mucilag...
CAA61198 315 AIMKHILEGSSYMKHAKKLGELDPLM-KPKQDRYALRTSPQWLGPQIEVIRAATKSIEREIN--SVNDNPLIDVSRGKAL 391 long-grained rice
CAA34226 306 AIMEHILAGSSFMSHAKKVNEMDPLL-KPKQDRYALRTSPQWLGPQIQVIRAATKSIEREVN--SVNDNPVIDVHRGKAL 382 Japanese rice
CAA09013 345 ENIWNLLDGSKLAQLEEHEVRLEDDKyTLRQDRYPLRTSPQFLGPQIEDIISAFQTVTQECNylPATDNPLIDGETGESH 424 fly agaric
1W27_A   394 HGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGrNPSLDYGFKGAEIAMASYCSELqflaNP 473 parsley
O23865   388 HGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGrNPSLDYGFKGAEIAMASYCSELqflgNP 467 carrot
P52777   399 HGGNFQGTPIGVSMDNLRLSISAIGKLMFAQFSELVNDYYNGGLPSNLSGGpNPSLDYGLKGAEIAMASYTSELlylaNP 478 loblolly pine
P10248   411 HGGAFMASSVGNTMEKTRLAVALMGKVSFTQLTEMLNAGMNRALPSCLAAE-DPSLSYHCKGLDIAAAAYTSELghlaNP 489 Rhodotorula mucilag...
CAA61198 392 HGGNFQGTPIGLSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGrNPSLDYGFKGAEIAMASYCSELqflgNP 471 long-grained rice
CAA34226 383 HGGNFQGTPIGVSMDNARLAIANIGKLMFAQFSELVNEFYNNGLTSNLAGSrNPSLDYGFKGTEIAMASYSSELqylaNP 462 Japanese rice
CAA09013 425 HGGNFQAMAVTNAMEKTRLALHHVGKLLFSQSTELVNPAMNRGLPPSVAAT-DPSLNYHAKGLDIATAAYVAEA----TP 499 fly agaric
1W27_A   474 VTNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSSVAKRVLTMGVNGE 553 parsley
O23865   468 VTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSTTFLVGLCQAVDLRHLEENLKSTVKNTVSQVAKKVLTMGVNGE 547 carrot
P52777   479 VTSHVQSAEQHNQDVNSLGLVSARKSAEAIDILKLMLSTYLTALCQAVDLRHLEENMLATVKQIVSQVAKKTLSTGLNGE 558 loblolly pine
P10248   490 VSTHVQPAEMGNQAINSLALISARRTAEANDVLSLLLATHLYCVLQAVDLRAMEFEHTKAFEPMVTELLKQHFGALATAE 569 Rhodotorula mucilag...
CAA61198 472 VTNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLIALCQAVDLRHIEENVKSAVKSCVMTVAKKTLSTNSTGD 551 long-grained rice
CAA34226 463 ITNHVQSAEQHNQDVNSLGLVSARKTLEAVDILKLMTSTYIVALCQAVDLRHLEENIKSSVKNCVTQVAKKVLTMNPTGD 542 Japanese rice
CAA09013 500 GPTHIQSAEMHNQAVNSLALISARATITSLEVLTSLIASYLYILCQALDLRALQREFLPGLDIIIREELRSSFGSFLSSE 579 fly agaric
1W27_A   554 LHPSRFCEKD--LLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNER-N-LsTSIFQKIATFEDELKALLP 629 parsley
O23865   548 LHPSRFCELD--LLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEK-NlS-TSIFQKIAAFEDELKALLP 623 carrot
P52777   559 LLPGRFCEKD--LLQVVDNEHVFSYIDDPCNASYPLTQKLRNILVEHAFKNAEGEK-DpN-TSIFNKIPVFEAELKAQLE 634 loblolly pine
P10248   570 VEDKVRKSIY----KRLQQNNSYDLEQRWHDTFSVATGAVVEALAGQEVS-----------LASLNAWKVACAEKAIALT 634 Rhodotorula mucilag...
CAA61198 552 LHVARFCEKD--LLKEIDREGVFAYGDDPCSHNYPLMKKLRNVLVERALANAGRVQrR-H-LGVRQGR-AVRGGLRATLP 626 long-grained rice
CAA34226 543 LSSARFSEKN--LLTAIDREAVFSYADDPCSANYPLMQKLRAVLVEHALTSGDRRA-R-G-LRVLQDHQV-RGGAPLCAA 616 Japanese rice
CAA09013 580 QMEKLQQNLTsaFEDHLDKTTTMDNTDRMTTMAATSSSVLLQFFTDSGASVPPSSC-D-L-LSSVSSFQSSVATRSSVLM 656 fly agaric
1W27_A   630 KEVESARAALESGNPAIPNRIEecRSYPLYKFVRKELGTEYLTGEKVT-----------SPGEEFEKVFIAMSKGEIIDP 698 parsley
O23865   624 KEVESARAVVESGNPAIPNRIKecRSYPLYKFIREELGTVYLTGEKVT-----------SPGEEFDKVFTAMSKGEIIDP 692 carrot
P52777   635 PQVSLARESYDKGTSPLPDRIQecRSYPLYEFVRNQLGTKLLSGTRTI-----------SPGEVIEVVYDAISEDKVIVP 703 loblolly pine
P10248   635 RSVRDSFWAAPSSSSPALKYLSp-RTRVLYSFVREEVGVKARRGDVYlgk------qevTIGTNVSRIYEAIKSGCIAPV 707 Rhodotorula mucilag...
CAA61198 627 GAIDGRAAVEN-GTAAIPSRITecRSYPLYRFVREELGTKYLTGEKTR-----------SPGEELNKVLVAINEGKHIDP 694 long-grained rice
CAA34226 617 PGDRGRPRRRRQRTAPVANRIVesRSFPLYRFVREELGCVFLTGEKLK-----------SPGEECNKVFLGISQGKLIDP 685 Japanese rice
CAA09013 657 DDLRKEYIFGDRGPTPASQYIG--KTRPVYQFIRTTIGVRKHGSENYNkfynglgvedvTIGQNISRIYESIRDGKMQSI 734 fly agaric
1W27_A   699 LLECLE 704 parsley
O23865   693 LLACLE 698 carrot
P52777   704 LFKCLD 709 loblolly pine
P10248   708 LVKMMA 713 Rhodotorula mucilaginosa
CAA61198 695 LLECLK 700 long-grained rice
CAA34226 686 MLDCLK 691 Japanese rice
CAA09013 735 IVSLFD 740 fly agaric
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap