1GK3


Conserved Protein Domain Family
hutH

?
TIGR01225: hutH 
Click on image for an interactive view with Cn3D
histidine ammonia-lyase
This enzyme deaminates histidine to urocanic acid, the first step in histidine degradation. It is closely related to phenylalanine ammonia-lyase. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 200086
Aligned: 9 rows
Threshold Bit Score: 677.961
Threshold Setting Gi: 501246274
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GK3_A         3 LTLKPGTLTLAQLRAIHAAPVRLQLDASAAPAIDASVACVEQIIAEDRTAYGINTGFGLLASTRIASHDLENLQRSLVLS 82  Pseudomonas putida
P10944         2 VTLDGSSLTTADVARVLFDFEEAAASEESMERVKKSRAAVERIVRDEKTIYGINTGFGKFSDVLIQKEDSAALQLNLILS 81  Bacillus subtil...
Q9RZ06         1 MILDR-DLNLEQFISVVRHGEQVELSAAARERIARARTVIEQIVEGDTPIYGVNTGFGKFENVQIDRSQLAQLQHNLIVS 79  Deinococcus rad...
AAA26769       6 VVVGTSGTTAEDVVAVARHGARVELSAAAVEALAAARLIVDALAAKPEPVYGVSTGFGALASRHIGTELRAQLQRNIVRS 85  Streptomyces gr...
O31197         3 VILRPGSVPLSDLETIYWTGAPARLDAAFDAGIAKAAARIAEIVAGNAPVYGINTGFGKLASIKIDSSDVATLQRNLILS 82  Sinorhizobium m...
AAA25840       4 LTLKPGTLTLAQLRAIHAAPVRLQLDASAAPAIDASVACVEQIIAEDRTAYGINTGFGLLASTRIASHDLENLQRSLVLS 83  Pseudomonas putida
WP_012289292   6 VVIDGESLTPAAVDAVARHDAPVSIAAGAREAVRESRARIADVLGGDEAVYGVNTGFGSMSDTRIDAADREALQANLVRS 85  Halobacterium s...
WP_010900671   2 IEIDGRSLRVEDVYAVAVEYDRVSISDDTLKAVEEKHEAFLKLINSGKTVYGVNTGFGSLLNVHIERDQEIELQKNLIRS 81  Thermoplasma ac...
P42357       114 IELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTVIPINKLQELQVNLVRS 193 human
P10944         2 VTLDGSSLTTADVARVLFDFEEAAASEESMERVKKSRAAVERIVRDEKTIYGINTGFGKFSDVLIQKEDSAALQLNLILS 81  Bacillus subtil...
Q9RZ06         1 MILDR-DLNLEQFISVVRHGEQVELSAAARERIARARTVIEQIVEGDTPIYGVNTGFGKFENVQIDRSQLAQLQHNLIVS 79  Deinococcus rad...
AAA26769       6 VVVGTSGTTAEDVVAVARHGARVELSAAAVEALAAARLIVDALAAKPEPVYGVSTGFGALASRHIGTELRAQLQRNIVRS 85  Streptomyces gr...
O31197         3 VILRPGSVPLSDLETIYWTGAPARLDAAFDAGIAKAAARIAEIVAGNAPVYGINTGFGKLASIKIDSSDVATLQRNLILS 82  Sinorhizobium m...
AAA25840       4 LTLKPGTLTLAQLRAIHAAPVRLQLDASAAPAIDASVACVEQIIAEDRTAYGINTGFGLLASTRIASHDLENLQRSLVLS 83  Pseudomonas putida
WP_012289292   6 VVIDGESLTPAAVDAVARHDAPVSIAAGAREAVRESRARIADVLGGDEAVYGVNTGFGSMSDTRIDAADREALQANLVRS 85  Halobacterium s...
WP_010900671   2 IEIDGRSLRVEDVYAVAVEYDRVSISDDTLKAVEEKHEAFLKLINSGKTVYGVNTGFGSLLNVHIERDQEIELQKNLIRS 81  Thermoplasma ac...
P42357       114 IELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTVIPINKLQELQVNLVRS 193 human
1GK3_A        83 HAAGIGAPLDDDLVRLIMVLKINSLSRGFSGIRRKVIDALIALVNAEVYPHIPLKGSVGASGALAPLAHMSLVLLGEGKA 162 Pseudomonas putida
P10944        82 HACGVGDPFPECVSRAMLLLRANALLKGFSGVRAELIEQLLAFLNKRVHPVIPQQGSLGASGDLAPLSHLALALIGQGEV 161 Bacillus subtil...
Q9RZ06        80 HAIGMGEPLPAEVVRGMLLLRAQSLSLGHSGVRVEVVELLLALLNADALPVVPSQGSVGASGDLAPLAHLALGLIGLGDI 159 Deinococcus rad...
AAA26769      86 HAAGMGPRVEREVVRALMFLRLKTVASGHTGVRPEVAQTMADVLNAGITPVVHEYGSLGCSGDLAPLSHCALTLMGEGEA 165 Streptomyces gr...
O31197        83 HCCGVGQPLTEDIVRLIMALKLISLGRGASGVRLELVRLIEAMLDKGVIPLIPEKGSVGASGDLAPLAHMAAVMMGHGEA 162 Sinorhizobium m...
AAA25840      84 HAAGIGAPLDDDLVRLIMVLKINSLSRGFSGIRRKVIDALIALVNAEVYPHIPLKGSVGASGDLAPLATMSLVLLGEGKA 163 Pseudomonas putida
WP_012289292  86 HAAGAGSELDTAAVRALLVTRLNALAKGYSGIRERVLDVLVGLLNEGVHPVVPSRGSLGASGDLAPLAHMSRVLIGEGQA 165 Halobacterium s...
WP_010900671  82 HSSGVGDYLENRYVRAIMAVRLNSLAAGYSAVSADLLNMMVEMLNRDVIPAVPKYGSVGASGDLAPLAHIGLAMMGEGKA 161 Thermoplasma ac...
P42357       194 HSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKM 273 human
P10944        82 HACGVGDPFPECVSRAMLLLRANALLKGFSGVRAELIEQLLAFLNKRVHPVIPQQGSLGASGDLAPLSHLALALIGQGEV 161 Bacillus subtil...
Q9RZ06        80 HAIGMGEPLPAEVVRGMLLLRAQSLSLGHSGVRVEVVELLLALLNADALPVVPSQGSVGASGDLAPLAHLALGLIGLGDI 159 Deinococcus rad...
AAA26769      86 HAAGMGPRVEREVVRALMFLRLKTVASGHTGVRPEVAQTMADVLNAGITPVVHEYGSLGCSGDLAPLSHCALTLMGEGEA 165 Streptomyces gr...
O31197        83 HCCGVGQPLTEDIVRLIMALKLISLGRGASGVRLELVRLIEAMLDKGVIPLIPEKGSVGASGDLAPLAHMAAVMMGHGEA 162 Sinorhizobium m...
AAA25840      84 HAAGIGAPLDDDLVRLIMVLKINSLSRGFSGIRRKVIDALIALVNAEVYPHIPLKGSVGASGDLAPLATMSLVLLGEGKA 163 Pseudomonas putida
WP_012289292  86 HAAGAGSELDTAAVRALLVTRLNALAKGYSGIRERVLDVLVGLLNEGVHPVVPSRGSLGASGDLAPLAHMSRVLIGEGQA 165 Halobacterium s...
WP_010900671  82 HSSGVGDYLENRYVRAIMAVRLNSLAAGYSAVSADLLNMMVEMLNRDVIPAVPKYGSVGASGDLAPLAHIGLAMMGEGKA 161 Thermoplasma ac...
P42357       194 HSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKM 273 human
1GK3_A       163 R-YKGQWLSATEALAVAGLEPLTLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSRSPFDARIH 241 Pseudomonas putida
P10944       162 F-FEGERMPAMTGLKKAGIQPVTLTSKEGLALINGTQAMTAMGVVAYIEAEKLAYQTERIASLTIEGLQGIIDAFDEDIH 240 Bacillus subtil...
Q9RZ06       160 E-YQGQVRPAADVLAELGLSPVQLQAKEGLALINGTQLMGSLLALALHDAQVLLGTANLAAAMTVEARYGSHRPFQPDVV 238 Deinococcus rad...
AAA26769     166 EgPDGTVRPAGELLAAHGIAPVELREKEGLALLNGTDGMLGMLVMALADLRNLYTSADITAALSLEALLGTDKVLAPELH 245 Streptomyces gr...
O31197       163 F-FAGERMKGDAALKAAGLSPVTLAAKEGLALINGTQVSTALALAGLFRAHRAGQAALITGALSTDAAMGSSAPFHPDIH 241 Sinorhizobium m...
AAA25840     164 R-YKGQWLSATEALAVAGLEPLTLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSRSPFDARIH 242 Pseudomonas putida
WP_012289292 166 D-VAGERMPAAEALAAADLEPVTLQAKEGLALINGTQLTTGVAALALVDAERVLRSADTAGALTTEVTMSTTASCAPAIH 244 Halobacterium s...
WP_010900671 162 F-FEGRLMDSARALEKAGLKPYQFKEKEGVALINGTSFMSGILSIAVMDAHDILENAIRSALLSFEALGGTSKAFTPWIL 240 Thermoplasma ac...
P42357       274 WsPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIH 353 human
P10944       162 F-FEGERMPAMTGLKKAGIQPVTLTSKEGLALINGTQAMTAMGVVAYIEAEKLAYQTERIASLTIEGLQGIIDAFDEDIH 240 Bacillus subtil...
Q9RZ06       160 E-YQGQVRPAADVLAELGLSPVQLQAKEGLALINGTQLMGSLLALALHDAQVLLGTANLAAAMTVEARYGSHRPFQPDVV 238 Deinococcus rad...
AAA26769     166 EgPDGTVRPAGELLAAHGIAPVELREKEGLALLNGTDGMLGMLVMALADLRNLYTSADITAALSLEALLGTDKVLAPELH 245 Streptomyces gr...
O31197       163 F-FAGERMKGDAALKAAGLSPVTLAAKEGLALINGTQVSTALALAGLFRAHRAGQAALITGALSTDAAMGSSAPFHPDIH 241 Sinorhizobium m...
AAA25840     164 R-YKGQWLSATEALAVAGLEPLTLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSRSPFDARIH 242 Pseudomonas putida
WP_012289292 166 D-VAGERMPAAEALAAADLEPVTLQAKEGLALINGTQLTTGVAALALVDAERVLRSADTAGALTTEVTMSTTASCAPAIH 244 Halobacterium s...
WP_010900671 162 F-FEGRLMDSARALEKAGLKPYQFKEKEGVALINGTSFMSGILSIAVMDAHDILENAIRSALLSFEALGGTSKAFTPWIL 240 Thermoplasma ac...
P42357       274 WsPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIH 353 human
1GK3_A       242 EARGQRGQIDTAACFRDLLG----DSsEVSLSHk-NADKVQDPYSLRCQPQVMGACLTQLRQAAEVLGIEANAVSDNPLV 316 Pseudomonas putida
P10944       241 LARGYQEQIDVAERIRFYLS----DS-GLTTSQ--GELRVQDAYSLRCIPQVHGATWQTLGYVKEKLEIEMNAATDNPLI 313 Bacillus subtil...
Q9RZ06       239 GLRPHPGALAVAAELREFLA----GS-EIAPSHltGDGKVQDAYSLRAVPQVHGATWDALAQAERVLAVEFASVTDNPLI 313 Deinococcus rad...
AAA26769     246 AIRPHPGQGVSADNMSRVLA----GS-GLTGHHqdDAPRVQDAYSVRCAPQVNGAGRDTLDHAALVAGRELASSVDNPVV 320 Streptomyces gr...
O31197       242 TLRGHKGQIDTAAALRQLLT----GS-PIRQSHieGDERVQDPYCIRCQPQVDGACLDLLRSVAATLTIEANAVTDNPLV 316 Sinorhizobium m...
AAA25840     243 EARGQRGQIDTAACFRDLLG----DSsEVSLSHk-NCDKVQDPYSLRCQPQVMGACLTQLRQAAEVLGIEANAVSDNPLV 317 Pseudomonas putida
WP_012289292 245 EVRPHDGQAVSARHIRNLTA----GS-EVLDHHr-DCDRVQDAYSIRCLPQVHGAVRDALDHLRAAVATELNSATDNPLV 318 Halobacterium s...
WP_010900671 241 GARPHLGQVAIGNRFREYLT----GS-DIVKRA--DSVKVQDAYTLRCIPQVYGSVADVIDYVENVLSVEINSATDNPLF 313 Thermoplasma ac...
P42357       354 ALRPHRGQIEVAFRFRSLLDsdhhPS-EIAESHr-FCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITTELNSATDNPMV 431 human
P10944       241 LARGYQEQIDVAERIRFYLS----DS-GLTTSQ--GELRVQDAYSLRCIPQVHGATWQTLGYVKEKLEIEMNAATDNPLI 313 Bacillus subtil...
Q9RZ06       239 GLRPHPGALAVAAELREFLA----GS-EIAPSHltGDGKVQDAYSLRAVPQVHGATWDALAQAERVLAVEFASVTDNPLI 313 Deinococcus rad...
AAA26769     246 AIRPHPGQGVSADNMSRVLA----GS-GLTGHHqdDAPRVQDAYSVRCAPQVNGAGRDTLDHAALVAGRELASSVDNPVV 320 Streptomyces gr...
O31197       242 TLRGHKGQIDTAAALRQLLT----GS-PIRQSHieGDERVQDPYCIRCQPQVDGACLDLLRSVAATLTIEANAVTDNPLV 316 Sinorhizobium m...
AAA25840     243 EARGQRGQIDTAACFRDLLG----DSsEVSLSHk-NCDKVQDPYSLRCQPQVMGACLTQLRQAAEVLGIEANAVSDNPLV 317 Pseudomonas putida
WP_012289292 245 EVRPHDGQAVSARHIRNLTA----GS-EVLDHHr-DCDRVQDAYSIRCLPQVHGAVRDALDHLRAAVATELNSATDNPLV 318 Halobacterium s...
WP_010900671 241 GARPHLGQVAIGNRFREYLT----GS-DIVKRA--DSVKVQDAYTLRCIPQVYGSVADVIDYVENVLSVEINSATDNPLF 313 Thermoplasma ac...
P42357       354 ALRPHRGQIEVAFRFRSLLDsdhhPS-EIAESHr-FCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITTELNSATDNPMV 431 human
1GK3_A       317 FA-----------AEGDVISGGNFHAEPVAMAADNLALAIAEIGSLSERRISLMMDK--HMS-QLPPFLVENGGVNSGFM 382 Pseudomonas putida
P10944       314 FN-----------DGDKVISGGNFHGQPIAFAMDFLKIAISELANIAERRIERLVNP--QLN-DLPPFLSPHPGLQSGAM 379 Bacillus subtil...
Q9RZ06       314 FP-----------ETGEVVSGGNFHGQPLAVTIDALKVAVAELGSISERRTEQLLNP--ALS-GLPAFLTPNGGLNSGFM 379 Deinococcus rad...
AAA26769     321 LP-----------DG-RVESNGNFHGAPVAYVLDFLAIVAADLGSICERRTDRLLDK--NRShGLPPFLADDAGVDSGLM 386 Streptomyces gr...
O31197       317 LS-----------DN-SVVSGGNFHAEPVAFAADQIALAVCEIGAISQRRIALLVDP--ALSyGLPAFLAKKPGLNSGLM 382 Sinorhizobium m...
AAA25840     318 FA-----------AEGDVISGGNFHAEPVAMAADNLALAIAEIGSLSERRISLMMDK--HMS-QLPPFLVENGGVNSGFM 383 Pseudomonas putida
WP_012289292 319 FAgdrvgprasgtDRAAVVSGGNFHGEVLALRLGYAASALAELAAISERRTDRLLNPetQEP-HLEPFLAPDSGLHSGLM 397 Halobacterium s...
WP_010900671 314 NG-----------E--EVVSGGNFHGEPVALAADFLAIALTDLGNMVERRIARLVDT--NLS-GLPPFLTPDSGLNSGYM 377 Thermoplasma ac...
P42357       432 FA-----------NRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNP--SLS-ELPAFLVAEGGLNSGFM 497 human
P10944       314 FN-----------DGDKVISGGNFHGQPIAFAMDFLKIAISELANIAERRIERLVNP--QLN-DLPPFLSPHPGLQSGAM 379 Bacillus subtil...
Q9RZ06       314 FP-----------ETGEVVSGGNFHGQPLAVTIDALKVAVAELGSISERRTEQLLNP--ALS-GLPAFLTPNGGLNSGFM 379 Deinococcus rad...
AAA26769     321 LP-----------DG-RVESNGNFHGAPVAYVLDFLAIVAADLGSICERRTDRLLDK--NRShGLPPFLADDAGVDSGLM 386 Streptomyces gr...
O31197       317 LS-----------DN-SVVSGGNFHAEPVAFAADQIALAVCEIGAISQRRIALLVDP--ALSyGLPAFLAKKPGLNSGLM 382 Sinorhizobium m...
AAA25840     318 FA-----------AEGDVISGGNFHAEPVAMAADNLALAIAEIGSLSERRISLMMDK--HMS-QLPPFLVENGGVNSGFM 383 Pseudomonas putida
WP_012289292 319 FAgdrvgprasgtDRAAVVSGGNFHGEVLALRLGYAASALAELAAISERRTDRLLNPetQEP-HLEPFLAPDSGLHSGLM 397 Halobacterium s...
WP_010900671 314 NG-----------E--EVVSGGNFHGEPVALAADFLAIALTDLGNMVERRIARLVDT--NLS-GLPPFLTPDSGLNSGYM 377 Thermoplasma ac...
P42357       432 FA-----------NRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNP--SLS-ELPAFLVAEGGLNSGFM 497 human
1GK3_A       383 IAQVTAAALASENKALSHPHSVDSLPTSANQEDHVSMAPAAGKRLWEMAENTRGVLAIEWLGACQGLDLRKGL--KTSAK 460 Pseudomonas putida
P10944       380 IMQYAAASLVSENKTLAHPASVDSIPSSANQEDHVSMGTIAARHAYQVIANTRRVIAIEAICALQAVEYRGIE--HAASY 457 Bacillus subtil...
Q9RZ06       380 IAQYTSAALVSENKVLSHPASVDSIPTSANQEDHVSMGAHAARQLRQIVANVQTVLSIELLCAAQGLDFQQLR--AGRG- 456 Deinococcus rad...
AAA26769     387 IAQYTQAALVSEMKRLAVPASADSIPSSAMQEDHVSMGWSAARKLRTAVDNLARIVAVELYAATRAIELRAAEglTPAPA 466 Streptomyces gr...
O31197       383 IAEVTSAALMSENKQLSHPASVDSTPTSANQEDHVSMACHGARRLLQMTENLFSIIGIEALAAVQGIEFRAPL--TTSPE 460 Sinorhizobium m...
AAA25840     384 IAQVTAAALASENKALSHPHSVDSLPTSANQEDHVSMAPAAGKRLWEMAENTRGVPAIEWLGACQGLDLRKGL--KTSAK 461 Pseudomonas putida
WP_012289292 398 IPQYTAASLVNDLRSLGQPT-LDNASVSGAQEDHVSMSAGAAYNFREAVEKAATVVGVELLCGAQGREFLDPDl-ALGAG 475 Halobacterium s...
WP_010900671 378 IPQYTAAALCNRNKVLAYPSSADTIPTSANQEDHVSMGATGSLKLLEIIDNVRYIIAIEYLLGSQALEFTDKG--MSPS- 454 Thermoplasma ac...
P42357       498 IAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPL--KTTTP 575 human
P10944       380 IMQYAAASLVSENKTLAHPASVDSIPSSANQEDHVSMGTIAARHAYQVIANTRRVIAIEAICALQAVEYRGIE--HAASY 457 Bacillus subtil...
Q9RZ06       380 IAQYTSAALVSENKVLSHPASVDSIPTSANQEDHVSMGAHAARQLRQIVANVQTVLSIELLCAAQGLDFQQLR--AGRG- 456 Deinococcus rad...
AAA26769     387 IAQYTQAALVSEMKRLAVPASADSIPSSAMQEDHVSMGWSAARKLRTAVDNLARIVAVELYAATRAIELRAAEglTPAPA 466 Streptomyces gr...
O31197       383 IAEVTSAALMSENKQLSHPASVDSTPTSANQEDHVSMACHGARRLLQMTENLFSIIGIEALAAVQGIEFRAPL--TTSPE 460 Sinorhizobium m...
AAA25840     384 IAQVTAAALASENKALSHPHSVDSLPTSANQEDHVSMAPAAGKRLWEMAENTRGVPAIEWLGACQGLDLRKGL--KTSAK 461 Pseudomonas putida
WP_012289292 398 IPQYTAASLVNDLRSLGQPT-LDNASVSGAQEDHVSMSAGAAYNFREAVEKAATVVGVELLCGAQGREFLDPDl-ALGAG 475 Halobacterium s...
WP_010900671 378 IPQYTAAALCNRNKVLAYPSSADTIPTSANQEDHVSMGATGSLKLLEIIDNVRYIIAIEYLLGSQALEFTDKG--MSPS- 454 Thermoplasma ac...
P42357       498 IAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPL--KTTTP 575 human
1GK3_A       461 LEKARQALRSEVAHYDR-DRFFAPDIEKAV-ELLAKGSLTGLLPAGVLPSL 509 Pseudomonas putida
P10944       458 TKQLFQEMRKVVPSIQQ-DRVFSYDIERLT-DWLKKESLIPDHQNKELRGM 506 Bacillus subtilis subsp. subtilis str. 168
Q9RZ06       457 VQAAYEYVRTFVPTLTE-DRYFRPDLLRLRgELVSGELLRVAQAADTQAPA 506 Deinococcus radiodurans R1
AAA26769     467 SEAVVAALRAAGAEGPGpDRFLAPDLAAAD-TFVREGRLVAAVE-PVTGPL 515 Streptomyces griseus
O31197       461 LQKAAAAVRGVSSSIEE-DRYMADDLKAAG-DLVASGRLAAAVSAGILPKL 509 Sinorhizobium meliloti 1021
AAA25840     462 LEKARQALRSEVAHYDR-DRFFAPDIEKAV-ELLAKGSLTGLLPAGVLPSL 510 Pseudomonas putida
WP_012289292 476 TAAAYDLVREVSEPVAG-DRALADDMAAVG-DLVRAGLVEDAVARALDAPL 524 Halobacterium salinarum
WP_010900671 455 TRKIYEKIREKVEKLDH-DRPPSFDIETIR-KMMDKKEFISALP------- 496 Thermoplasma acidophilum
P42357       576 LEKVYDLVRSVVRPWIK-DRFMAPDIEAAHrLLLEQKVWEVAAPYIEKYRM 625 human
P10944       458 TKQLFQEMRKVVPSIQQ-DRVFSYDIERLT-DWLKKESLIPDHQNKELRGM 506 Bacillus subtilis subsp. subtilis str. 168
Q9RZ06       457 VQAAYEYVRTFVPTLTE-DRYFRPDLLRLRgELVSGELLRVAQAADTQAPA 506 Deinococcus radiodurans R1
AAA26769     467 SEAVVAALRAAGAEGPGpDRFLAPDLAAAD-TFVREGRLVAAVE-PVTGPL 515 Streptomyces griseus
O31197       461 LQKAAAAVRGVSSSIEE-DRYMADDLKAAG-DLVASGRLAAAVSAGILPKL 509 Sinorhizobium meliloti 1021
AAA25840     462 LEKARQALRSEVAHYDR-DRFFAPDIEKAV-ELLAKGSLTGLLPAGVLPSL 510 Pseudomonas putida
WP_012289292 476 TAAAYDLVREVSEPVAG-DRALADDMAAVG-DLVRAGLVEDAVARALDAPL 524 Halobacterium salinarum
WP_010900671 455 TRKIYEKIREKVEKLDH-DRPPSFDIETIR-KMMDKKEFISALP------- 496 Thermoplasma acidophilum
P42357       576 LEKVYDLVRSVVRPWIK-DRFMAPDIEAAHrLLLEQKVWEVAAPYIEKYRM 625 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap