2BB0


Conserved Protein Domain Family
hutI

?
TIGR01224: hutI 
Click on image for an interactive view with Cn3D
imidazolonepropionase
This enzyme catalyzes the third step in histidine degradation. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 273512
Aligned: 8 rows
Threshold Bit Score: 483.067
Threshold Setting Gi: 499205335
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BB0_A        35 IEDAVVGIHE-QKIVFAGQKG----AEAGy----eADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDI 105 Bacillus subtilis
Q9RZ05        31 IEDAALLVRG-GVIQWVGPRA----AAPT------ATHVHDLGGRAVVPGLVDPHTHAVWAGDRLSDWEAKLQGATYEEI 99  Deinococcus rad...
Q9ZC74        27 IPQGAIAVTG-DKIVWIGPHA----ELPPi----hAARQVVYEGGLITPGLIDCHTHLVFGDDRSNEFEQRLNGVSYAEI 97  Yersinia pestis
P42084        35 IEDAVVGIHE-QKIVFAGQKG----AEAGy----eADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDI 105 Bacillus subtil...
AAC24449      39 SNSLVILVDTnGKFSYIGNLNgaenKLKGegvemeNLKIIDSNGGIAIPGFVDGHSHPVFSGDRVHEFAMKLAGATYMEV 118 Caenorhabditis ...
WP_000995897  23 TEPQTLIIEQ-GRIQHIGQHI----DLPS------DAHPISCAGKLVTPGLIDCHTHLVYAGSRANEFELRLQGVPYQTI 91  Vibrio cholerae
WP_010900667  30 YENHSILIHG-GRIAEITR------AVPP------GVEEIDCGGGVAVPGFVDPHTHIAFAGNRVQEFYMRIRGTSYLDI 96  Thermoplasma ac...
WP_010902875  31 gavavvdgavaavgdtadvLA----AYPAe----nATTAIDATGKTVLPGFVDPHTHALFAGDRSDEFAAKLRGKPYQEI 102 Halobacterium s...
Q9RZ05        31 IEDAALLVRG-GVIQWVGPRA----AAPT------ATHVHDLGGRAVVPGLVDPHTHAVWAGDRLSDWEAKLQGATYEEI 99  Deinococcus rad...
Q9ZC74        27 IPQGAIAVTG-DKIVWIGPHA----ELPPi----hAARQVVYEGGLITPGLIDCHTHLVFGDDRSNEFEQRLNGVSYAEI 97  Yersinia pestis
P42084        35 IEDAVVGIHE-QKIVFAGQKG----AEAGy----eADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDI 105 Bacillus subtil...
AAC24449      39 SNSLVILVDTnGKFSYIGNLNgaenKLKGegvemeNLKIIDSNGGIAIPGFVDGHSHPVFSGDRVHEFAMKLAGATYMEV 118 Caenorhabditis ...
WP_000995897  23 TEPQTLIIEQ-GRIQHIGQHI----DLPS------DAHPISCAGKLVTPGLIDCHTHLVYAGSRANEFELRLQGVPYQTI 91  Vibrio cholerae
WP_010900667  30 YENHSILIHG-GRIAEITR------AVPP------GVEEIDCGGGVAVPGFVDPHTHIAFAGNRVQEFYMRIRGTSYLDI 96  Thermoplasma ac...
WP_010902875  31 gavavvdgavaavgdtadvLA----AYPAe----nATTAIDATGKTVLPGFVDPHTHALFAGDRSDEFAAKLRGKPYQEI 102 Halobacterium s...
2BB0_A       106 LAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVstfMGAH 185 Bacillus subtilis
Q9RZ05       100 LARGGGIRSTMRATAAADVAELVALARPRLASLRASGATTTEVKSGYGLDFDAELRMLRAVRELQAEFELRPT---LLIH 176 Deinococcus rad...
Q9ZC74        98 AANGGGIISTVRATRQASEQQLLEQALFRLKPLLAEGVTTIEIKSGYGLNLESEIKMLRVARRLGELLPIDVKttcLAAH 177 Yersinia pestis
P42084       106 LAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVstfMGAH 185 Bacillus subtil...
AAC24449     119 QQAGGGIMFTTNKTREASEQDLRKDFEELAKKMLRSGTTTLEAKSGYGLNVDAEMKMLRVLATENPNIPLEVSatfCGAH 198 Caenorhabditis ...
WP_000995897  92 AAQGGGILSTVNATRKASEEALIELALPRLDGLLRSGVTSVEVKSGYGLTLKDELKMLRAAKALEQHRRVKITttlLAAH 171 Vibrio cholerae
WP_010900667  97 LRSGNGIYRTIRDTVNADENRIFKETISRVWSAVRRGTTTMEMKTGYGLDQRGEEKILSAIEVIKNTGPISVVp-tYLAH 175 Thermoplasma ac...
WP_010902875 103 LAEGGGILRTVDAVRAASDAALVANLTAQLDVMLAHGTTTAEVKTGYGLDTETECRMLDAIAAAAAEHPVDVVttfLGAH 182 Halobacterium s...
Q9RZ05       100 LARGGGIRSTMRATAAADVAELVALARPRLASLRASGATTTEVKSGYGLDFDAELRMLRAVRELQAEFELRPT---LLIH 176 Deinococcus rad...
Q9ZC74        98 AANGGGIISTVRATRQASEQQLLEQALFRLKPLLAEGVTTIEIKSGYGLNLESEIKMLRVARRLGELLPIDVKttcLAAH 177 Yersinia pestis
P42084       106 LAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVstfMGAH 185 Bacillus subtil...
AAC24449     119 QQAGGGIMFTTNKTREASEQDLRKDFEELAKKMLRSGTTTLEAKSGYGLNVDAEMKMLRVLATENPNIPLEVSatfCGAH 198 Caenorhabditis ...
WP_000995897  92 AAQGGGILSTVNATRKASEEALIELALPRLDGLLRSGVTSVEVKSGYGLTLKDELKMLRAAKALEQHRRVKITttlLAAH 171 Vibrio cholerae
WP_010900667  97 LRSGNGIYRTIRDTVNADENRIFKETISRVWSAVRRGTTTMEMKTGYGLDQRGEEKILSAIEVIKNTGPISVVp-tYLAH 175 Thermoplasma ac...
WP_010902875 103 LAEGGGILRTVDAVRAASDAALVANLTAQLDVMLAHGTTTAEVKTGYGLDTETECRMLDAIAAAAAEHPVDVVttfLGAH 182 Halobacterium s...
2BB0_A       186 AIPPEyqNDpDDFLDQML-SLLPEIKEQE------LASFADIFTETGVFTVSQ-------------SRRYLQKAAEAGFG 245 Bacillus subtilis
Q9RZ05       177 VPPQE--GR-AEYVVGVCaELIPQVAREG------LAEALDVFCEKEAFSVEE-------------TRTMFAAAQAHGLR 234 Deinococcus rad...
Q9ZC74       178 ALPPEfiGQpDDYIDVVCnSIIPQVAVEN------LADAVDAFCEHLAFSPAQ-------------VERVFLAAQKAGLP 238 Yersinia pestis
P42084       186 AIPPEyqNDpDDFLDQMLs-LLPEIKEQE------LASFADIFTETGVFTVSQ-------------SRRYLQKAAEAGFG 245 Bacillus subtil...
AAC24449     199 AVPKG--STeYEQTRMICeELIPKIEDEKrngglkNVENIDVFCEKGVFEVESrllaksiqflliySQKILKRGQEAGMA 276 Caenorhabditis ...
WP_000995897 172 ALPPEfqGRsDDYIAHICqEIIPRVAEEQ------LATSVDVFCESIGFSVAQ-------------TERVFHAAQAHGLQ 232 Vibrio cholerae
WP_010900667 176 VVPQDvqEN--AYVEGILeTVKRNRQR---------ISYADIFCDAGAFSPEA-------------SRRFLEAAIAMGIP 231 Thermoplasma ac...
WP_010902875 183 AVPDDtdA--DAYVDAVIdDQLPAAAN-G------PARFCDVFCEADVFTVEQ-------------SRRILDAGREHGLA 240 Halobacterium s...
Q9RZ05       177 VPPQE--GR-AEYVVGVCaELIPQVAREG------LAEALDVFCEKEAFSVEE-------------TRTMFAAAQAHGLR 234 Deinococcus rad...
Q9ZC74       178 ALPPEfiGQpDDYIDVVCnSIIPQVAVEN------LADAVDAFCEHLAFSPAQ-------------VERVFLAAQKAGLP 238 Yersinia pestis
P42084       186 AIPPEyqNDpDDFLDQMLs-LLPEIKEQE------LASFADIFTETGVFTVSQ-------------SRRYLQKAAEAGFG 245 Bacillus subtil...
AAC24449     199 AVPKG--STeYEQTRMICeELIPKIEDEKrngglkNVENIDVFCEKGVFEVESrllaksiqflliySQKILKRGQEAGMA 276 Caenorhabditis ...
WP_000995897 172 ALPPEfqGRsDDYIAHICqEIIPRVAEEQ------LATSVDVFCESIGFSVAQ-------------TERVFHAAQAHGLQ 232 Vibrio cholerae
WP_010900667 176 VVPQDvqEN--AYVEGILeTVKRNRQR---------ISYADIFCDAGAFSPEA-------------SRRFLEAAIAMGIP 231 Thermoplasma ac...
WP_010902875 183 AVPDDtdA--DAYVDAVIdDQLPAAAN-G------PARFCDVFCEADVFTVEQ-------------SRRILDAGREHGLA 240 Halobacterium s...
2BB0_A       246 LKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGkS-TYARARAMIDE-----GVCV 319 Bacillus subtilis
Q9RZ05       235 VKLHADQFHAIGGTELACEVGALSVDHLEASGAAQIAALAASETVATILPGVTLHLG-L-PAAPGRQLIDS-----GAIV 307 Deinococcus rad...
Q9ZC74       239 VKLHAEQLSALRGATLAAKFHAISADHLEYATESDVQAMANAGTVAVLLPGAYYLLReT-QCPPIDLFRQY-----KVPM 312 Yersinia pestis
P42084       246 LKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGkS-TYARARAMIDE-----GVCV 319 Bacillus subtil...
AAC24449     277 VNFHAEELKYIGGVEMGAKIGARAMSHLEEISDKGIRGMAQAGSVAVLLPSTAFILR-L-TPPPARKLIEN-----NVIV 349 Caenorhabditis ...
WP_000995897 233 IKGHTEQLSNLGGSALTARMGGLSVDHIEYLDEAGVKALAQSSTVATLLPGAFYFLR-EtQKPPIEWLRQY-----RVPM 306 Vibrio cholerae
WP_010900667 232 ARIHTNEIENVGCVKKTRGLPIVSYDHMIHFDDADLDIVKENGSSVTLLPITVFALN-E-AYPDARRIIDR-----GIPV 304 Thermoplasma ac...
WP_010902875 241 PKLHAEEFTRLGGAQLAADLGATSADHLLHATPEDAAALADAGVTPVLLPATAFVLD-E-AYADPQQFLAAadnrtGAPV 318 Halobacterium s...
Q9RZ05       235 VKLHADQFHAIGGTELACEVGALSVDHLEASGAAQIAALAASETVATILPGVTLHLG-L-PAAPGRQLIDS-----GAIV 307 Deinococcus rad...
Q9ZC74       239 VKLHAEQLSALRGATLAAKFHAISADHLEYATESDVQAMANAGTVAVLLPGAYYLLReT-QCPPIDLFRQY-----KVPM 312 Yersinia pestis
P42084       246 LKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGkS-TYARARAMIDE-----GVCV 319 Bacillus subtil...
AAC24449     277 VNFHAEELKYIGGVEMGAKIGARAMSHLEEISDKGIRGMAQAGSVAVLLPSTAFILR-L-TPPPARKLIEN-----NVIV 349 Caenorhabditis ...
WP_000995897 233 IKGHTEQLSNLGGSALTARMGGLSVDHIEYLDEAGVKALAQSSTVATLLPGAFYFLR-EtQKPPIEWLRQY-----RVPM 306 Vibrio cholerae
WP_010900667 232 ARIHTNEIENVGCVKKTRGLPIVSYDHMIHFDDADLDIVKENGSSVTLLPITVFALN-E-AYPDARRIIDR-----GIPV 304 Thermoplasma ac...
WP_010902875 241 PKLHAEEFTRLGGAQLAADLGATSADHLLHATPEDAAALADAGVTPVLLPATAFVLD-E-AYADPQQFLAAadnrtGAPV 318 Halobacterium s...
2BB0_A       320 SLATDFNPgSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKG-EeAGQLKAGRSADLVIWQAPNYMYIPYHYG 398 Bacillus subtilis
Q9RZ05       308 AIGTDLNPgSSPLFSTQLALALAVRLCLLTPAEALSACTVNAAYALGLS-D-RGSLSAGQRADFLVLNGQDWREVAYTLG 385 Deinococcus rad...
Q9ZC74       313 ALASDANPgTSPVLSLRLMLNMACTLFRMTPEEALAGVTCHAAQALGVQ-QtQGTLETGKLANWVHWPLSHPAELAYWLG 391 Yersinia pestis
P42084       320 SLATDFNPgSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKG-EeAGQLKAGRSADLVIWQAPNYMYIPYHYG 398 Bacillus subtil...
AAC24449     350 ALGSDFNP-NAYCLAMPMIMHFACVTMKLSMPEALTAATLNSAHSIGRG-KsHGAIAKGRNADFVILSANSWEHIIYRIA 427 Caenorhabditis ...
WP_000995897 307 AISTDLNPgTSPFADLSLMMNMGCTLFDLTPEETLRAVTCHAAQALGYP-AnRGQIAEGYDADLAIWNIEHPAELSYQVG 385 Vibrio cholerae
WP_010900667 305 SIATDISP-LNMNDDMIFAMHLAVRNNHMNAEEVLNAATINPAASLGLA-EkKGTIESGKDADLVVLSARSYDEIPYLYG 382 Thermoplasma ac...
WP_010902875 319 ALGTDLNP-NCYTHSMGFVVSLACNGMRMAPADAVLAATAWAASALDRGrDgTGTLREGTDGDVLVVDAPSHVHLPYNPG 397 Halobacterium s...
Q9RZ05       308 AIGTDLNPgSSPLFSTQLALALAVRLCLLTPAEALSACTVNAAYALGLS-D-RGSLSAGQRADFLVLNGQDWREVAYTLG 385 Deinococcus rad...
Q9ZC74       313 ALASDANPgTSPVLSLRLMLNMACTLFRMTPEEALAGVTCHAAQALGVQ-QtQGTLETGKLANWVHWPLSHPAELAYWLG 391 Yersinia pestis
P42084       320 SLATDFNPgSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKG-EeAGQLKAGRSADLVIWQAPNYMYIPYHYG 398 Bacillus subtil...
AAC24449     350 ALGSDFNP-NAYCLAMPMIMHFACVTMKLSMPEALTAATLNSAHSIGRG-KsHGAIAKGRNADFVILSANSWEHIIYRIA 427 Caenorhabditis ...
WP_000995897 307 AISTDLNPgTSPFADLSLMMNMGCTLFDLTPEETLRAVTCHAAQALGYP-AnRGQIAEGYDADLAIWNIEHPAELSYQVG 385 Vibrio cholerae
WP_010900667 305 SIATDISP-LNMNDDMIFAMHLAVRNNHMNAEEVLNAATINPAASLGLA-EkKGTIESGKDADLVVLSARSYDEIPYLYG 382 Thermoplasma ac...
WP_010902875 319 ALGTDLNP-NCYTHSMGFVVSLACNGMRMAPADAVLAATAWAASALDRGrDgTGTLREGTDGDVLVVDAPSHVHLPYNPG 397 Halobacterium s...
2BB0_A       399 VN--HVHQVMKNGTI 411 Bacillus subtilis
Q9RZ05       386 GN--AVAEVYLAGAQ 398 Deinococcus radiodurans R1
Q9ZC74       392 GQ--LPATVVFRGEV 404 Yersinia pestis
P42084       399 VN--HVHQVMKNGTI 411 Bacillus subtilis subsp. subtilis str. 168
AAC24449     428 AHhdVINYVIKNGNV 442 Caenorhabditis elegans
WP_000995897 386 VS--RLHARIVNGEL 398 Vibrio cholerae
WP_010900667 383 LD--IVSMTISRGNI 395 Thermoplasma acidophilum
WP_010902875 398 VN--NVEAVLTDgtv 410 Halobacterium salinarum
Q9RZ05       386 GN--AVAEVYLAGAQ 398 Deinococcus radiodurans R1
Q9ZC74       392 GQ--LPATVVFRGEV 404 Yersinia pestis
P42084       399 VN--HVHQVMKNGTI 411 Bacillus subtilis subsp. subtilis str. 168
AAC24449     428 AHhdVINYVIKNGNV 442 Caenorhabditis elegans
WP_000995897 386 VS--RLHARIVNGEL 398 Vibrio cholerae
WP_010900667 383 LD--IVSMTISRGNI 395 Thermoplasma acidophilum
WP_010902875 398 VN--NVEAVLTDgtv 410 Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap