3CH4


Conserved Protein Domain Family
Pmev_kin_anim

?
TIGR01223: Pmev_kin_anim 
Click on image for an interactive view with Cn3D
phosphomevalonate kinase, animal type
This enzyme is part of the mevalonate pathway, one of two alternative pathways for the biosynthesis of IPP. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found. One is this type, found in animals. The other is the ERG8 type, found in plants and fungi (TIGR01219) and in Gram-positive bacteria (TIGR01220). [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 130290
View PSSM: TIGR01223
Aligned: 3 rows
Threshold Bit Score: 168.72
Threshold Setting Gi: 1294782
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CH4_B    13 VLLFSGKRKSGKDFVTEALQSRLGADVCaVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGF 92  human
AAC37593  11 VLLFSGKRKSGKDFVTEALQSRLGADVCaVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGF 90  human
Q9VIT2     4 IVLISGKRKCGKDYISERLQRRLGSRSC-IVRISEPIKSEWARKLQLDLDALLGDGPYKEKYRRDMIVWSDEVRAQDYGY 82  fruit fly
3CH4_B    93 FCR-KIVEGIS---QPIWLVSDTRRVSDIQWFREAYG-AVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGD-F 166 human
AAC37593  91 FCR-KIVEGIS---QPIWLVSDTRRVSDIQWFREAYG-AVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGD-F 164 human
Q9VIT2    83 FCRvAMEEALSrqqTPYILVSDVRRKNDIRWFRETYGpERVITLRLTSRPETRSARGWTFTAGIDDVPSECDLDDLADgF 162 fruit fly
3CH4_B   167 DWVIENHgvEQRLEEQLENLIEFIRSRL 194 human
AAC37593 165 DWVIENHgvEQRLEEQLENLIEFIRSRL 192 human
Q9VIT2   163 DVVLAND--EELDQEAIDILLDRLQLQY 188 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap