Conserved Protein Domain Family
TIGR01212

?
TIGR01212: TIGR01212 
radical SAM protein, TIGR01212 family
Members of this family are apparent radical-SAM enzymes, related to the N-terminal region of the bifunctional ELP3, whose C-terminal region is part of the elongator complex and appears to acetylate histones and other proteins. ELP3 binds S-adenosylmethionine (SAM) and was recently shown to be involved in a DNA demethylation process in eukaryotes. Close sequence similarity of this family (with lacks the GNAT family acetyltransferase domain) to the ELP3 N-terminal region and a strong match to the pfam04055 support identification of this family as radical SAM despite the atypical spacing between first and second Cys residues in the 4Fe4S-binding motif. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 130279
View PSSM: TIGR01212
Aligned: 6 rows
Threshold Bit Score: 459.226
Threshold Setting Gi: 2496003
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45476         6 LVNMFGGDLTRRYGQKVHKLTLHGGFSCPNRDgtigRGGCTFCNVAS---FADeAQQHRSIAEQ-LAHQANLVNRA--KR 79  Escherichia coli
Q57910        23 LFAQYGIYIKKKFKQKIFKIPVDIGLGCPHKK----NGGCIFCPEMGrpiSVK-YCSAKIPLKEqIKKQMENQKKKgfKK 97  Methanocaldococ...
WP_009968016  15 RYHTLNYHLREHFGHKVFKVALDGGFDCPNRDgtvaHGGCTFCSAAGsgdFAGnRTDDLITQFHdIKNRMHEKWKD--GK 92  Bacillus subtilis
WP_001882065  10 LVNTIGQDLQRRYGEKVHKLTLHGGFSCPNRDgtigRGGCTFCNVAS---FADeNTQQQSIQAq-LKDRAGEIKRA--KK 83  Vibrio cholerae
WP_010880377   9 LYYSLKDYFKEKYGKRVQKITVALPFTCPNRDgtkgRGGCTYCYDGSkpsMLSpVIPLEVQIKEgIERAKKKYGED--IY 86  Aquifex aeolicus
WP_004081416   2 RYRKLSDYLKERYGERVQRIVIHGGFSCPNRDgtkgKGGCIYC-DATgsgFT---TLMRLPIREqVMEMKKKYEKRgiKK 77  Thermotoga mari...
P45476        80 YLAYFQAYTSTFAEVQVLRSMYQQAVSQANIVGLCVGTRPDCVPDAVLDLLCEYKDQGYEVWLELGLQTAHDKTLHRINR 159 Escherichia coli
Q57910        98 FYIYFYPGTNTYAPAEKLKEIWDFSLSYKEVIGLSIGTRPDCLEKEKLDILAEYVENGYDIWIDLGVQSMHQKTLEILNR 177 Methanocaldococ...
WP_009968016  93 YIAYFQAFTNTHAPVEVLREKFESVLALDDVVGISIATRPDCLPDDVVDYLAELNERTY-LWVELGLQTVHERTALLINR 171 Bacillus subtilis
WP_001882065  84 YLAYFQAYTSTYAEVQVLKSMYEQALEEADIVGLCVGTRPDCVPDAVLKLLADYVQQGYEIWLELGLQTAHDQTLKRINR 163 Vibrio cholerae
WP_010880377  87 FTIYYQSYTNTYADIETLKKVYDTALKFEGVVGIDVGTRPDCAPEEVLDLLEYYANKGLEVWVEYGLQSANFETLKKINR 166 Aquifex aeolicus
WP_004081416  78 FIAYFQSFSNTYAPVEMLRERYEEALVDDSIVQLSVSTRPDLVPERVLDLFEEFKKR-VDVSVELGLQTANYRTLKKINR 156 Thermotoga mari...
P45476       160 GHDFACYQRTTQLARQRGLKVCSHLIVGLPGEGQAECLQTLERVVETGVDGIKLHPLHIVKGSIMAKAWEAGRLNGIELE 239 Escherichia coli
Q57910       178 GHDVSDIIKAIKDCHKRGIKVCGHVILGLPGESWKEMMETAKILSLLEIEAVKIYPLVVVKGTKLEEMYWKGEYRTLDEN 257 Methanocaldococ...
WP_009968016 172 AHDFNCYVEGVNKLRKHGIRVCSHIINGLPLEDRDMMMETAKAVADLDVQGIKIHLLHLLKGTPMVKQYEKGKLEFLSQD 251 Bacillus subtilis
WP_001882065 164 GHDFACYAEITAKARALGIKVCTHLIVGLPGEERTENLTTLQQVLKVGTDGIKLHGLHIVEGSTMAKAWRAGRLTVLDQD 243 Vibrio cholerae
WP_010880377 167 QHGVSDFVDAVLRTKKRNLKVCAHMIIGLPGETREDFIETAKLIASLPIDGIKIHPLHVIKGTVMEKQYLNEEFKTLTLE 246 Aquifex aeolicus
WP_004081416 157 GHTLAEFVDAAVRVKKRGIELVVHVILNLPWDDMEDVVETAKILSALDVDGVKLHSLYVVEGTKLAEMYKKGEVKICSLE 236 Thermotoga mari...
P45476       240 DYTLTAGEMIRHTPPEVIYHRISAS-ARRPTLLAPLWC--ENRWTGMVELDRYLNEHG-VQGSALGR 302 Escherichia coli
Q57910       258 QYISLVCDFLEHLSPYVLIQRLSKDkVPESIKVSPEWY--LGRLKIMNKVSEILKKRGtKQGARFFR 322 Methanocaldococcus jannaschi...
WP_009968016 252 DYVQLVCDQLEIIPPEMIVHRITGD-GPIELMIGPMWS--VNKWEVLGAINKELENRGsYQGKFFQR 315 Bacillus subtilis
WP_001882065 244 QYVSIACEMIRSTPPEIVYHRVSSA-ARRPTLLAPLWC--ENRWWAMTAIGQRLEKEG-AQGSLLGT 306 Vibrio cholerae
WP_010880377 247 EYAEYCADVIELLPPDMVVHRITGE-TDEERLIAPEWCtfKYKNAVIQKVRETLERRGtYQGARYPF 312 Aquifex aeolicus
WP_004081416 237 EYIDRAITFLEYLSPNVVIHRLVAD-PPRKGTIFGNWG--KSKIEIINMIEEELERRDtYQGKKFDY 300 Thermotoga maritima
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap