1H5T,1FXO,1MC3


Conserved Protein Domain Family
rmlA

?
TIGR01207: rmlA 
Click on image for an interactive view with Cn3D
glucose-1-phosphate thymidylyltransferase, short form
Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 130274
View PSSM: TIGR01207
Aligned: 11 rows
Threshold Bit Score: 552.769
Threshold Setting Gi: 489496754
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1H5T_A         5 KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQP 84  synthetic const...
P27831         2 KGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQP 81  Escherichia coli
P37744         5 KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQP 84  Escherichia col...
WP_010981057   2 KGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITAPEDNASFKRLLGDGSDFGISISYAVQP 81  Neisseria menin...
WP_011713070   2 KGIVLAGGSGTRLHPVTIPISKQLLPIYDKPMIYYPLTTLMLAGIRDILIISTPQDTPRFEQLLGDGSNWGVSLSYAVQP 81  Magnetococcus m...
1FXO_A         4 KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQP 83  Pseudomonas aer...
WP_010889302   6 KGIILAGGSGTRLYPATLAVSKQLLPIYDKPMIYYPLTTLMLGGMREILIISTPEDTPRFKQLLGDGSQWGIALEYAVQP 85  Deinococcus rad...
1MC3_A         5 KGIILAGGSGTRLHPITRGVSKQLLPIYDKPXIYYPLSVLXLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQP 84  Escherichia coli
WP_010892796   5 KGIILAGGAGTRLYPITQGIGKQLLPVYDKPMIYYPLSVLMLAGIRQVLVITMLHEQPLFQRLLGDGTQWGMEICYAVQA 84  Xylella fastidiosa
WP_010877393   2 KGIVLAGGSGTRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPLYRDLLGDGSQFGVRFSYRVQE 81  Methanothermoba...
WP_003401670   2 RGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQD 81  Mycobacterium t...
1H5T_A        85 SPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKP 164 synthetic const...
P27831        82 SPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEKP 161 Escherichia coli
P37744        85 SPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKP 164 Escherichia col...
WP_010981057  82 SPDGLAQAFIIGEEFIGNDNVCLVLGDNIFYGQSFTQTLKQAAAQTHGATVFAYQVKNPERFGVVEFNENFRAVSIEEKP 161 Neisseria menin...
WP_011713070  82 SPDGLAQAFIIAEDFLDRQPCTMILGDNIFFGHDLSQVLQRVALRQQGATVFAYAVSDPERYGVVHFDSQGRALGIEEKP 161 Magnetococcus m...
1FXO_A        84 SPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKP 163 Pseudomonas aer...
WP_010889302  86 KPEGLAQAFLIGEDFVQGHPSSLILGDNIFYGNDLSDLMQAANAKENGATVFAYQVRDPERYGVVDFDRSGRALSIEEKP 165 Deinococcus rad...
1MC3_A        85 SPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVXDPERFGVVEFDDNFRAISLEEKP 164 Escherichia coli
WP_010892796  85 SPDGVAQSYLIGRAFVDDKPSCLILGDNIFYGHGLTDTLCHADARTVGATVFGYWVSDPERYGVAEFDGDGRVINIEEKP 164 Xylella fastidiosa
WP_010877393  82 EPRGIADAFIVGKDFIGDSKVALVLGDNVFYGHRFSEILRRAASLEDGAVIFGYYVRDPRPFGVVEFDSEGRVISIEEKP 161 Methanothermoba...
WP_003401670  82 QPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGA-IFAYWVANPSAYGVVEFGAEGMALSLEEKP 160 Mycobacterium t...
1H5T_A       165 LEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIE 244 synthetic const...
P27831       162 KQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEASTFVQTVE 241 Escherichia coli
P37744       165 LEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIE 244 Escherichia col...
WP_010981057 162 QRPKSDWAVTGLYFYDNRAVEFAKQLKPSARGELEISDLNRMYLEDGSLSVQILGRGFAWLDTGTHESLHEAASFVQTVQ 241 Neisseria menin...
WP_011713070 162 AKPKSRYAVTGLYCYDQHVVEYARALRPSPRGELEITDLNNRYLAEGSLSVERLGRGYAWLDTGTHDSLLRAATFVETLD 241 Magnetococcus m...
1FXO_A       164 LEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLE 243 Pseudomonas aer...
WP_010889302 166 AQPKSDFAVTGLYFYDERVSEIARSIKPSPRGELEITDLNNVYLEEGALDVQLMRRGFAWLDTGTHESMLDASLFIQTIE 245 Deinococcus rad...
1MC3_A       165 KQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQXYLEAGNLTVELLGRGFAWLDTGTHDSLIEASTFVQTVE 244 Escherichia coli
WP_010892796 165 AQPRSNYAVTGLYFYDGRAPAFAAELTPSARGELEITDLNRRYLAEGALHLEALGRGYAWLDTGTHQSLQDASNFIGTIQ 244 Xylella fastidiosa
WP_010877393 162 SRPKSNYVVPGLYFYDNQVVEIARRIEPSDRGELEITSVNEEYLRMGKLRVELMGRGMAWLDTGTHDGLLEASSFIETIQ 241 Methanothermoba...
WP_003401670 161 VTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLE 240 Mycobacterium t...
1H5T_A       245 ERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTK 290 synthetic construct
P27831       242 KRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQYLLELLR 287 Escherichia coli
P37744       245 ERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTK 290 Escherichia coli K-12
WP_010981057 242 NIQNLHIACLEEIAWRNGWLSDEKLEELARTMAKNQYGQYLLRLLK 287 Neisseria meningitidis
WP_011713070 242 KRQGVKIACPEEVSFRMGWIDQAQLRALAQPYLKNGYGQYLLRVCE 287 Magnetococcus marinus
1FXO_A       244 NRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLT 289 Pseudomonas aeruginosa
WP_010889302 246 QRQGLKVASPEEIAWRSGWISTQALLEQAERLKKNQYGKYLIKIAQ 291 Deinococcus radiodurans
1MC3_A       245 KRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQYLLELLR 290 Escherichia coli
WP_010892796 245 TRQGLQVCCPEEVAFWKGWIDATHLERLAAPLAKNAYGQYLLNLAQ 290 Xylella fastidiosa
WP_010877393 242 KRQGFYIACLEEIAYNNGWITREDVLEMAEKLEKTDYGKYLRDLAE 287 Methanothermobacter thermautotrophicus
WP_003401670 241 RRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLE 286 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap