Conserved Protein Domain Family
bioW

?
TIGR01204: bioW 
6-carboxyhexanoate--CoA ligase
Alternate name: pimeloyl-CoA synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin]
Statistics
?
PSSM-Id: 130271
View PSSM: TIGR01204
Aligned: 3 rows
Threshold Bit Score: 349.215
Threshold Setting Gi: 499183538
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P22822        18 EGGEKHISGGERIGSEFQIEPIVKQLLNKARNHSRGDADFIQITVEKLTgDQILYMPPLEITTIDESSIERAHKEARSIL 97  Lysinibacillus ...
P53559        21 EDGGKHISGGERLIPFHEMKHTVNALLEKGLSHSRGKPDFMQIQFEEVH-ESIKTIQPLPVHTNEVSCPEEGQKLARLLL 99  Bacillus subtil...
WP_010881078  11 QKNGKHVSGAERIVKKEELETAVKELLNRPK-----EFDFMNVKVEKVKdFEVVKFN-LKISTYSFKSPEEAREFAVKKL 84  Aquifex aeolicus
P22822        98 TSVGVSKQAQNVAFHLLASNQN-----LRGAILLHSQTGLRLDNRGLKGVRVSRIDWQDA---------DVGYNERVREA 163 Lysinibacillus ...
P53559       100 EKEGVSRDVIEKAYEQIPEWSD-----VRGAVLFDIHTGKRMDQTKEKGVRVSRMDWPDAnfekwalhsHVPAHSRIKEA 174 Bacillus subtil...
WP_010881078  85 TQEGIKEEVAKKAVEILSKGANpkggnMRGAVLMDIETGERLEEDKERGVRTIHFDWKDRkkvt-ekllKEGYTLRTVDA 163 Aquifex aeolicus
P22822       164 LALATKVANSPYTIAELCWSDDPEYVTGYVSNHEIGYVRITPLKREGCESGGRIFFVSDEVELESYIHYLEREPILIR 241 Lysinibacillus sp...
P53559       175 LALASKVSRHPAVVAELCWSDDPDYITGYVAGKKMGYQRITAMKEYGTEEGCRVFFIDGSNDVNTYIHDLEKQPILIE 252 Bacillus subtilis...
WP_010881078 164 LALTFKNLFCG-VVAELCWSDDPDYVTGYVSGKEIGYVRITPLKEKGDPLGGRVYFVSRK-ELSEIIECLTQKVVLIE 239 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap