Conserved Protein Domain Family
bchC

?
TIGR01202: bchC 
2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase
[Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 130269
View PSSM: TIGR01202
Aligned: 4 rows
Threshold Bit Score: 493.986
Threshold Setting Gi: 6690728
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF24296       2 RTTAVILSGPRDLGLQTIQLNEPAPGDIVVEITHSGISTGTEKLFYTGQMPPFPGMGYPLVPGYEAAGEVVEAAPDTGF- 80  Rhodobacter sph...
P16565         2 ETQVVIMSGPKAISTGIAGLTDPGPGDLVVDIAYSGISTGTEKLFWLGTMPPFPGMGYPLVPGYESFGEVVQAAPDTGF- 80  Rhodobacter cap...
BAA94034       2 KTQAIVLEQPEHLVLRELELTPPTDEDLVVDIEYSGISTGTEKLLWSGRMPAFPGMGYPLVPGYESVGRVVQAGANAHH- 80  Rubrivivax gela...
WP_010933089   5 KSKAIVFSGVNQIELREVTLKPVSSTDVLVETWWSSISTGTEKMALNGLIPSPP-FIFPFIPGYETVGRIVEAGDHVNQg 83  Chlorobaculum t...
AAF24296      81 RPGDRVFVPGSNCFAptdagPIRGLFGAATKRLVTPAHRAVRIDPALEAEG-ALLALAATARHALAG----LNHVLPDLI 155 Rhodobacter sph...
P16565        81 RPGDHVFIPGANCFTg----GLRGLFGGASKRLVTAASRVCRLDPAIGPEG-ALLALAATARHALAG----FDNALPDLI 151 Rhodobacter cap...
BAA94034      81 KVGERVFVPGARCYG-----EVRGLFGGAASRVVVAGSRVCNVSDSLGEQA-VLLALAATAYHSVAGggkrTPIVPPDLI 154 Rubrivivax gela...
WP_010933089  84 LIGKFAYVAGSFGYE-----DVNAAFGGASQFIVCPVESLTVLDGIANPQCgIALPLGATALHIVDLa---EVKNRKVLV 155 Chlorobaculum t...
AAF24296     156 VGHGTLGRLLARLTIAAGGEPPVVWETKAERRRHAEGYEVIDPATD------QRRDYRSIYDASGDPKLIDSLVMRLAKG 229 Rhodobacter sph...
P16565       152 VGHGTLGRLLARLTLAAGGKPPMVWETNPARRTGAVGYEVLDPEAD------PRRDYKAIYDASGAPGLIDQLVGRLGKG 225 Rhodobacter cap...
BAA94034     155 VGHGVLGRLLARMTVVAGFPAPTVWETNPTRAQGATGYAVLHPDED------PRRDYRAIFDVSGDSAILDRLVERLAKG 228 Rubrivivax gela...
WP_010933089 156 LGQGAVGILAAELAKRFGASLVAVTEPHQRRLDISTSDIKVNPEKQdvsvalAGHEFDVLIDSTGIMSAIETGLRFLKFH 235 Chlorobaculum t...
AAF24296     230 GEIVLAGFYTEPVAFTFVPAFMKEARLRIAAEWQPEDMVATRALIESGALSLANLITHTRPASE-AAEAYATGLSDPDCL 308 Rhodobacter sph...
P16565       226 GELVLCGFYTVPVSFAFVPAFMKEMRLRIAAEWQPADLSATRALIESGALSLDGLITHRRPAAE-AAEAYQTAFEDPDCL 304 Rhodobacter cap...
BAA94034     229 GEIVLAGFYTEPLHFNFAPAFMREAQIRCAAEWQRPDLLAVKELAETGRLSLDGLITHHASPSD-AAAAYRTAFGDPDCL 307 Rubrivivax gela...
WP_010933089 236 GKVIFGGYYQR-MNIDYSQAFNKELSFIAARQWAKGDLHRVRELIAAGKINAEKIFTHQCTVDDnLMEAYMQAFSDSDCL 314 Chlorobaculum t...
AAF24296     309 KMILD 313 Rhodobacter sphaeroides
P16565       305 KMILD 309 Rhodobacter capsulatus
BAA94034     308 KMVLD 312 Rubrivivax gelatinosus IL144
WP_010933089 315 KMIIH 319 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap