Conserved Protein Domain Family
nramp

?
TIGR01197: nramp 
NRAMP (natural resistance-associated macrophage protein) metal ion transporters
This model describes the Nramp metal ion transporter family. Historically, in mammals these proteins have been functionally characterized as proteins involved in the host pathogen resistance, hence the name - NRAMP. At least two isoforms Nramp1 and Nramp2 have been identified. However the exact mechanism of pathogen resistance was unclear, until it was demonstrated by expression cloning and electrophysiological techniques that this protein was a metal ion transporter. It was also independently demonstrated that a microcytic anemia (mk) locus in mouse, encodes a metal ion transporter (DCT1 or Nramp2). The transporter has a broad range of substrate specificity that include Fe+2, Zn+2, Mn+2, Co+2, Cd+2, Cu+2, Ni+2 and Pb+2. The uptake of these metal ions is coupled to proton symport. Metal ions are essential cofactors in a number of biological process including, oxidative phosphorylation, gene regulation and metal ion homeostasis. Nramp1 could confer resistance to infection in one of the two ways. (1) The uptake of Fe+2 can produce toxic hydroxyl radicals via Fenton reaction killing the pathogens in phagosomes or (2) Deplete the metal ion pools in the phagosome and deprive the pathogens of metal ions, which is critical for its survival. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 162246
View PSSM: TIGR01197
Aligned: 7 rows
Threshold Bit Score: 449.173
Threshold Setting Gi: 3025117
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P38778  55 RKYARFIGPGLMVSVSYMDPGNYSTAVAAGSAHRYKLLFSVLVSNFMAAFWQYLCARLGAVTGLDLAQNCKKHLPFGLNI 134 Saccharomyces cerevis...
P38925  74 AKYLKFIGPGLMVSVAYIDPGNYSTAVDAGASNQFSLLCIILLSNFIAIFLQCLCIKLGSVTGLDLSRACREYLPRWLNW 153 Saccharomyces cerevis...
Q10177  69 REYCKFIGPGFLIAVAYIDPGNYSTDLDAGSRFQYKLLFIVFLSNLFAVYLQSLCIRLGSVTGMDLARNCREHYNRYICW 148 Schizosaccharomyces p...
P49282  68 RKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRI 147 house mouse
P56436  53 RKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRI 132 red deer
P49283  75 RKLWAFTGPGFLMSIAYLDPGNIESDMQSGAAAKYKILWVLLWATVLGLLMQRLAARLGVVTGLHLAEMCYRQYKRLPRW 154 fruit fly
P96593  28 RGLLPFLGPAFIAAIAYIDPGNFATNISAGSKYGYMLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKPVSI 107 Bacillus subtilis sub...
P38778 135 TLYILAEMAIIATDLAEVVGTAISLNILFH--IPLALGVILTVVDVLIVLLAYKPngs-mkGIRIFEAFVSLLVVLTVVC 211 Saccharomyces cerevis...
P38925 154 TLYFFAECAVIATDIAEVIGTAIALNILIK--VPLPAGVAITVVDVFLIMFTYKPgassirFIRIFECFVAVLVVGVCIC 231 Saccharomyces cerevis...
Q10177 149 SFYVLAEIAIIATDIAEVIGTAVALKILMH--IPLVAGVVITILDVLLVLIAWRPegs-mlSVRIFETAVALLVLVVAIS 225 Schizosaccharomyces p...
P49282 148 ILWLMVELAIIGSDMQEVIGSAIAINLLSAgrVPLWGGVLITIADTFVFLFLDKY------GLRKLEAFFGFLITIMALT 221 house mouse
P56436 133 LLWLTIELAIVGSDMQEVIGTAIAFSLLSAgrIPLWGGVLITIVDTFFFLFLDNY------GLRKLEAFFGFLITIMALT 206 red deer
P49283 155 ILWIMIEIAIIGSDMQEVIGTAIAIYLLSNkvVPLWGGVLITIVDTFTFLFLDKY------GLRKLEFLFGTLITIMAVS 228 fruit fly
P96593 108 GLWIQGELVIIATDLAEFIGAALGLYLLFG--IPMLEASIIAAIGSFAILELQRR------GYRSLEAGIAGMLFVVVIA 179 Bacillus subtilis sub...
P38778 212 FTVELFYAKLG-PAKEIFSGFLPSKAVFEGDGLYLSLAILGATVMPHSLYLGSGVVQPRLREYDIKNGhylPDAnDMdnn 290 Saccharomyces cerevis...
P38925 232 FAIELAYIPKStSVKQVFRGFVPSAQMFDHNGIYTAISILGATVMPHSLFLGSALVQPRLLDYDVKHGnytVSE-EQdkv 310 Saccharomyces cerevis...
Q10177 226 FAVVLGRVHIG-GAGTVFKGFLPSSTVFSREGLYSSIGILGATVMPHSLFLGSGLVQTRLRDLDVRRGnytPVG-DCs-- 301 Schizosaccharomyces p...
P49282 222 FGYEYITVKPS-QSQVLRGMFVPSCPGCRTPQVEQAVGIVGAVIMPHNMYLHSALVKSRQVNRANKQE---VREaNK--- 294 house mouse
P56436 207 FGYEYVVARPA-QGALLQGLFLPSCAGCGQPELLQAVGIVGAIIMPHNIYLHSSLVKSREVDRSRRAD---IREaNM--- 279 red deer
P49283 229 FGYEYIVSAPN-QGEVLEGMFVPWCSNCNSNVLLQAVGVVGAVIMPHNLYLHSALVKSRDIDRRQTKK---VSEaNF--- 301 fruit fly
P96593 180 FALQTFFAKPD-AVSVMKGLFVP--AFHGTDSVLLAAGILGATVMPHAIYLHSALTQRRVVGKTDAER------------ 244 Bacillus subtilis sub...
P38778 291 -------------hdnYRPSYEAISETLHFTITELLISLFTVALFVNCAILIVSG---------ATLYGSTQn----AEE 344 Saccharomyces cerevis...
P38925 311 kksksteeimeekyfnYRPTNAAIKYCMKYSMVELSITLFTLALFVNCAILVVAG---------STLYNSPE-----ADG 376 Saccharomyces cerevis...
Q10177 302 ---------------dYRPTHETIKHSLTYSIVEVALSLFTFALFTNSSILIVAG---------AVFYNTSG-----ADT 352 Schizosaccharomyces p...
P49282 295 ----------------YFFIESCIALFVSFIINVFVVSVFAEAFFEKTNKQVVEVcknn-ssphADLFPSDNs----TLA 353 house mouse
P56436 280 ----------------YFLIEATIALSVSFLINLFVMAVFGQAFYKQTNQAAFNIcansslhdyATIFPRNNl----TVA 339 red deer
P49283 302 ----------------YFFIEASVALFVSFIINLFVVAVFAHGMYGKTNNDVVEVckdksmyedAKMSFVDNvngtaIID 365 fruit fly
P96593 245 -----------------------K-KIFRFEFIDILIAMLIAGAINASMLIVAAA----------LFF-KNG-----LFV 284 Bacillus subtilis sub...
P38778 345 ADLFSIYNLLCSTLSKGAGTVFVLALLFSGQSAGIVCTLSGQMVSEGFLNWTVSPALRRSATRAVAITPCLILVLVAGRS 424 Saccharomyces cerevis...
P38925 377 ADLFTIHELLSRNLAPAAGTIFMLALLLSGQSAGVVCTMSGQIVSEGHINWKLQPWQRRLATRCISIIPCLVISICIGRE 456 Saccharomyces cerevis...
Q10177 353 SDLFSIYDLLKEYVSISCGRLFAVALLFSGMSAGYVCTIAGQIVSEGYINWNLRPWLRRVITRAIAIIPCLVVSAAVGQS 432 Schizosaccharomyces p...
P49282 354 VDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVILTRSIAIIPTLLVAVFQDVE 433 house mouse
P56436 340 VDIYQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVLLTRSCAILPTVLVAVFRDLR 419 red deer
P49283 366 ADLYKGGLFLGCTFGAVAMYIWGVGILAAGQSSTMTGTYAGQFSMEGFLNLQWPRWCRVLVTRCIAIIPTFCLAMFSKME 445 fruit fly
P96593 285 EDLDVAFQQFGHLVSPMSAALFGIGLLVAGLSSSSVGTLSGDVIMQGFINYRIPLYVRRFIT----IIPPILIIASG--V 358 Bacillus subtilis sub...
P38778 425 GLSGALNASQVVLSLLLPFVSAPLLYFTSSKKIM 458 Saccharomyces cerevisiae S288c
P38925 457 ALSKALNASQVVLSIVLPFLVAPLIFFTCKKSIM 490 Saccharomyces cerevisiae S288c
Q10177 433 GLNQVLNASQVCLSILLPFLTFPLVMFTCSRKVM 466 Schizosaccharomyces pombe 972h-
P49282 434 HLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVM 467 house mouse
P56436 420 DLSGLNDLLNVLQSLLLPFAVLPILTFTSMPAVM 453 red deer
P49283 446 DLTSMNDILNAVMSLQLPFAAIPTIAFTSCAAIM 479 fruit fly
P96593 359 NPTTALVLSQVVLSFGIAFALIPLIMFTSNKRIM 392 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap