Conserved Protein Domain Family
edd

?
TIGR01196: edd 
6-phosphogluconate dehydratase
A close homolog, designated MocB (mannityl opine catabolism), is found in a mannopine catabolism region of a plasmid of Agrobacterium tumefaciens. However, it is not essential for mannopine catabolism, branches within the cluster of 6-phosphogluconate dehydratases (with a short branch length) in a tree rooted by the presence of other dehydyatases. It may represent an authentic 6-phosphogluconate dehydratase, redundant with the chromosomal copy shown to exist in plasmid-cured strains. This model includes mocB above the trusted cutoff, although the designation is somewhat tenuous. [Energy metabolism, Entner-Doudoroff]
Statistics
?
PSSM-Id: 130264
View PSSM: TIGR01196
Aligned: 5 rows
Threshold Bit Score: 1116.05
Threshold Setting Gi: 2497349
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9Z3S0         4 DSRIAAITARIVERSKPYREPYLDRVRSAATNGPHRTV-LGCGNLAHGFAVCSPAEKVALAGDRVPNLGIITSYNDMLSA 82  Sinorhizobium m...
P25530         2 NPQLLRVTNRIIERSRETRSAYLARIEQAKTSTVHRSQ-LACGNLAHGFAACQPEDKASLKSMLRNNIAIITSYNDMLSA 80  Escherichia coli
AAA03487       2 HPRVLEVTRRIQARSAATRQRYLEMVRAAASKGPHRGT-LPCGNLAHGVAACGESDKQTLRLMNQANVAIVSAYNDMLSA 80  Pseudomonas aer...
P56111         4 HS-LEQIKEKITERSKKTRELYLENIFNPKNQPKIES--LGCANIAHVTASMPEHLKMPLGSHKRKHFAIITAYNDMLSA 80  Helicobacter py...
WP_002222315   7 HSKLAEITGRIIERSRPTREKYLAKIRSAKQMGRLERNqLGCSNLAHGYAAMPKSIKIEMLQETVPNLGIITAYNDMVSA 86  Neisseria menin...
Q9Z3S0        83 HQPF-ETYPALIRE-AAHEAGGVAQVAGGVPAMCDGVTQGQPGMELSLFSRDVIAMAAGIGLSHNMFDAAVYLGVCDKIV 160 Sinorhizobium m...
P25530        81 HQPY-EHYPEIIRK-ALHEANAVGQVAGGVPAMCDGVTQGQDGMELSLLSREVIAMSAAVGLSHNMFDGALFLGVCDKIV 158 Escherichia coli
AAA03487      81 HQPVrAPFRGLIKPgACTRSVRSASVAGGVPAMCDGVTQGEPGMELSLASRDVIAMSTAIALSHNMFDAALCLGVCDKIV 160 Pseudomonas aer...
P56111        81 HQPF-KNYPDLIKK-ELQEHNAYASVASGVPAMCDGITQGYDGMELSLFSRDVIALSTAVGLSHNVFDGAFFLGVCDKIV 158 Helicobacter py...
WP_002222315  87 HQPF-KDFPDQIKD-EAQKNGATAQVAGGTPAMCDGITQGYAGMELSLFSRDVIAMSTAIGLSHQMFDGSLFMGVCDKIV 164 Neisseria menin...
Q9Z3S0       161 PGLAIAALTFGHLPAVFIPAGPMTTGLPNDEKAKVRQLFAEGKVGRDELLEAESKSYHGPGTCTFYGTANSNQM-LMEIM 239 Sinorhizobium m...
P25530       159 PGLTMAALSFGHLPAVFVPSGPMASGLPNKEKVRIRQLYAEGKVDRMALLESEAASYHAPGTCTFYGTANTNQM-VVEFM 237 Escherichia coli
AAA03487     161 PGL-LSAASFGHLPTVFVPGGPMPTGISNKEKAAVRQLFAEGKATREELLASEMASYHAPGTCTFYGTANTNQVrLVEVM 239 Pseudomonas aer...
P56111       159 PGLLIGALSFGNLASVFVPSGPMVSGIENYKKAKARQDFAMGKINREELLKVEMQSYHDVGTCTFYGTANSNQM-MMEFM 237 Helicobacter py...
WP_002222315 165 PGLMIGALSFGHIPGIFVPAGPMSSGIGNKEKARTRQLFAEGKVGRNELLKSEMGSYHSPGTCTFYGTANSNQM-MMEMM 243 Neisseria menin...
Q9Z3S0       240 GFHLPGASFINPGTPLRDALTREATKRALAITALGNEFTPAGEMIDERSIVNGVVGLHATGGSTNHTMHLVAMARAAGIV 319 Sinorhizobium m...
P25530       238 GMQLPGSSFVHPDSPLRDALTAAAARQVTRMTGNGNEWMPIGKMIDEKVVVNGIVALLATGGSTNHTMHLVAMARAAGIQ 317 Escherichia coli
AAA03487     240 GLHLPGASFVNPNTPLRDELSREAARQASRLTPENGNYVPMAEIVDEKAIVNSVVALLATGGSTNHTLHLLAIAQAAGIQ 319 Pseudomonas aer...
P56111       238 GLHVANSSFINPNNPLRKVLVEESAKRLAS-----GKVLPLAKLIDEKSILNALIGLMATGGSTNHTLHLIAIARSCGVI 312 Helicobacter py...
WP_002222315 244 GVHLPAAAFVHPYTDLREALTRYAAGHLARGI-KNGTIKPLGEMLTEKSFINALIGLMATGGSTNHTMHLVAMARAAGVI 322 Neisseria menin...
Q9Z3S0       320 LTWQDISELSDLVPLLARVYPNGLADVNHFHAAGGMGFLIAQLLRKGLLHDDVRTVYG----QGLSAYAIDVKLGEnGSV 395 Sinorhizobium m...
P25530       318 INWDDFSDLSDVVPLMARLYPNGPADINHFQAAGGVPVLVRELLKAGLLHEDVNTVAG----FGLSRYTLEPWLNN-GEL 392 Escherichia coli
AAA03487     320 LTWQDMSELSHVVPTLARIYPNGQADINHFQAAGGMSFLIRQLLDGGLLHEDVQTVAG----PGLRRYTREPFLED-GRL 394 Pseudomonas aer...
P56111       313 LNWDDFDAVSNLIPLLAKVYPNGSADVNAFEACGGLVFVIKELLKEGLLFEDTHTIMDtetqKGMQNYTKTPFLEN-NQL 391 Helicobacter py...
WP_002222315 323 LNWDDFDEISSIIPLLIRVYPNGKADVNHFTAAGGLPFVIRELLNAGLLHDDVDTVVG----HGMRHYTKEPFLID-GKL 397 Neisseria menin...
Q9Z3S0       396 KREPAPEASADPKVLATVDRPFQHTGGLKMLSGNIGKAVIKISAVKPESHVIEAPAKIFNDQAELNAAFKAGKLEGDFVA 475 Sinorhizobium m...
P25530       393 DWREGAEKSLDSNVIASFEQPFSHHGGTKVLSGNLGRAVMKTSAVPVENQVIEAPAVVFESQHDVMPAFEAGLLDRDCVV 472 Escherichia coli
AAA03487     395 VWREGPERSLDEAILRPLDKPFSAEGGLRLMEGNLGRGVMKVSAVAPEHQVVEAPVRIFHDQASLAAAFKAGELERDLVA 474 Pseudomonas aer...
P56111       392 VYKDAINHSLNTDILRPVSDPFAANGGLKILKGNLGRAVIKISAIKDEHRKVKARAIVFKTQSEFLERFKNKELERDFVA 471 Helicobacter py...
WP_002222315 398 EWREAPETSGNDDILRKADNPFSPDGGLRLMKGNIGRGVIKVSAVREGCRIIEAPAIVFNDQREVLAAFERGELERDFVC 477 Neisseria menin...
Q9Z3S0       476 VVRFQGPKANGMPELHKLTTVLGILQDRGQKVAILTDGRMSGASGKVPAAIHVTPEAKEGGPIARIQEGDIVRIDAINGK 555 Sinorhizobium m...
P25530       473 VVRHQGPKANGMPELHKLMPPLGVLLDRCFKIALVTDGRLSGASGKVPSAIHVTPEAYDGGLLAKVRDGDIIRVNGQTGE 552 Escherichia coli
AAA03487     475 VVRFQGPRANGMPELHKLTPFLGVLQDRGFKVALVTDGRMSGASGKVPAAIHVSPEAIAGGPLARLRDGDRVRVDGVNGE 554 Pseudomonas aer...
P56111       472 VLPFQGPKSNGMPELHKLTTNLGALQDMGYKVALVTDGRMSGASGKVPSAIHLSPEGALNGAIIKIKDGDLIELDAPNNA 551 Helicobacter py...
WP_002222315 478 VVRYQGPRANGMPELHKLTPPLGILQDRGFKVALLTDGRMSGASGKVPASIHMTPEALMGGNIAKIRTGDLIRFDSVSGE 557 Neisseria menin...
Q9Z3S0       556 VEVLVEDIA---LKTRVPAHID-LSDNEFGMGRELFAPFRQIAGAADRGGSVLF 605 Sinorhizobium meliloti 1021
P25530       553 LTLLVDEAE---LAAREPHIPD-LSASRVGTGRELFSALREKLSGAEQGATCIT 602 Escherichia coli
AAA03487     555 LRVLVDDAE---WQARS-LEPA-PQDGNLGCGRELFAFMRNAMSSAEEGACSFT 603 Pseudomonas aeruginosa PAO1
P56111       552 LNVLEKDFEkrgINPLFLETLEnLEKPSFGLGRELFTSLRLNVNTAEEGGMSFG 605 Helicobacter pylori 26695
WP_002222315 558 LNVLINETE---WNAREVESID-LGANQQGCGRELFANFRSMTSSAETGAMSFG 607 Neisseria meningitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap