Conserved Protein Domain Family
cyc_pep_trnsptr

?
TIGR01194: cyc_pep_trnsptr 
cyclic peptide transporter
This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake. [Transport and binding proteins, Amino acids, peptides and amines, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130262
View PSSM: TIGR01194
Aligned: 2 rows
Threshold Bit Score: 938.226
Threshold Setting Gi: 466460
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P33951     7 KKARPGSIMRLLWsSHPWLTFFTLLTGLISGVASIAVVNVINQAIHEETFQRQ-SLFWFVGLSVVALLFRNGASLFPAYA 85  Pseudomonas syringa...
AAB60200   5 KRGAIRELLALLR-PFRAIVAVSIALGMAGGLAITLLLASINNALHSENGLGQgVLLSFGGLCLLALVSSIVSDIGTSYV 83  Pseudomonas aeruginosa
P33951    86 SMRIMTRLRIALCRKILGTPLEEVDRRGAPNVLTLLTSDIPQLNATLLIMPTILVESAVFLFGIAYLAYLSWVVFAITIS 165 Pseudomonas syringa...
AAB60200  84 GQHIIANVRKELGEKVLSAPIEQIERYRTHRLIPVLTHDIDTISDFSFSFTPLAIALTITFGCLGYLAYLSVPMFLLTVV 163 Pseudomonas aeruginosa
P33951   166 LMILGVAMYLLFFMGGMKFTHKVRDEFTAFNEYTHALVFGLKELKLNGIrRRWFSRSAIQESSVRVAKYNYIERLWFTAA 245 Pseudomonas syringa...
AAB60200 164 AIVIGTAAQYLARSRGFKGFYAARDLEDELQKHYTAIASGAKELRIHRP-SLSHAHGRISETANNIRDLHISSINIFILA 242 Pseudomonas aeruginosa
P33951   246 ENVGQLTLSLLVGCLLFAAPMFAVIDAKTMSASVLAVLYIMGPLVMLVSAMPMLAQGRIACTRLADFGFSINEPHPEPET 325 Pseudomonas syringa...
AAB60200 243 KTFGSMLFFVVIGLALTLQAYWPSSNPAAITGFVMVLLYMKGPLEQVVTILPIVSRAQVAFQRVAELSERFSSPEPHLLL 322 Pseudomonas aeruginosa
P33951   326 SDADnvlllDHKKSWGSIQLKNVHMNYKDPQSSSGFALGPIDLTIHSGELVYIVGGNGCGKSTLAKVFCGLYIPQEGQLL 405 Pseudomonas syringa...
AAB60200 323 SEQE-----APDKTVDSLELRDVRYSPPAVEGSEPFHLGPINLRIAQGDIVFIVGENGCGKTTLIKLLLGLYRPQSGEIL 397 Pseudomonas aeruginosa
P33951   406 LDGAAVTDDSRGDYRDLFSAVFSDFHLFNRLIGpdeKEHPSTDQAQTYLSTLGLEDKVKIEGLGYStTTALSYGQQKRLA 485 Pseudomonas syringa...
AAB60200 398 LNGEPVSAETRDDYRQLFSTIFADYYLFDDLVQ---GKQASLQNATQYLQRLEIAHKVSVMDGNFS-TTDLSTGQRKRLA 473 Pseudomonas aeruginosa
P33951   486 LVCAYLEDRPIYLLDEWAADQDPPFKRFFYEELLPDLKRRGKTILIITHDDQYFQLADRIIKLADGCIVSDVKCA 560 Pseudomonas syringae pv....
AAB60200 474 LINAWLEERPVLVFDEWAADQDPAFRRVFYTELLPDLKRQGKTIIVISHDDRYFEMADQLIRLSAGKVVKETETA 548 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap