Conserved Protein Domain Family
bacteriocin_ABC

?
TIGR01193: bacteriocin_ABC 
ABC-type bacteriocin transporter
This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130261
View PSSM: TIGR01193
Aligned: 5 rows
Threshold Bit Score: 1102.87
Threshold Setting Gi: 3849842
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P36497    13 QVDENDCGLAALNMILKYYGSDYMLAHLRQLAKTTADGTTVLGLVKAAKHLNLNAEAVRADMDALTASQLPLPVIVHVFK 92  Pediococcus acidila...
Q10418    16 QVDERDCGVAALAMILAHYKTRLSLAKLRDLAKTDMEGTTALGIVKAANALDFETMPIQADLSLFDKKDLPYPFIAHVIK 95  Leuconostoc mesente...
Q00564    11 QVDEMDCGCAALSMILKSYGTEKSLASLRLLAGTTIEGTSALGIKKAAEILEFSVQALRTDASLFEMKNAPYPFIAHVIK 90  Lactococcus lactis ...
CAD20391  14 QVDEDDCGIAALNMIFKNFGSEYSLSKLRFLAKTSQQGTTIFGLIKAAEELNLEANALQADMGIFKDENLMLPIIAHVLK 93  Lactobacillus sakei
CAA11805   8 QVDNKDCGIAALSMIMKKYNTNISLSKLRQLAHTDLNGTTVLGLTKAAEYFKFETKVINANENFLEDNTFEAPFIVHVVK 87  Carnobacterium dive...
P36497    93 KNKLPHYYVVYQVTENDLIIGDPDPTVKTTKISKSQFAKEWTQIAIIIAPTVKYKPIKESRHTLIDLVPLLIKQKRLIGL 172 Pediococcus acidila...
Q10418    96 EGKYPHYYVVYGMKGDQLLIADPDNTVGKTKMTKAHFNEEWTGVSIFIAPNPTYKPTKEKKRSLTSFIPVITRQKLLVIN 175 Leuconostoc mesente...
Q00564    91 DQKYPHYYVITGANKNSVFIADPDPTIKMTKLSKEAFLSEWTGISLFLSTTPSYHPTKEKASSLLSFIPIITRQKKVILN 170 Lactococcus lactis ...
CAD20391  94 QGKVLHYYVVFDVSKDFLIIGDPDPTIGITEISKKDFENEWTGNFITFSKGKNFVSEKQRNNSLLKFIPILRQQKSLIFW 173 Lactobacillus sakei
CAA11805  88 NEILAHYYVIYEITKNHILVADPDSDVGIFKMKKEDFYEQWTGIAMFIFPSLEYTPISLKENSFKKFFPLILEKKKLVVI 167 Carnobacterium dive...
P36497   173 IITAAAITTLISIAGAYFFQLIIDTYLPHLMTNRLSLVAIGLIVAYAFQAIINYIQSFFTIVLGQRLMIDIVLKYVHHLF 252 Pediococcus acidila...
Q10418   176 IVIAALLVTLVSILGSYYLQGIIDTYIPNNMKNTLGIVSLGLIFAYVIQQLLSYARDYLLIVMGQRLSIDIILSYIKHIF 255 Leuconostoc mesente...
Q00564   171 IVIASFIVTLINILGSYYLQSMIDSYIPNALMGTLGIISVGLLLTYIIQQVLEFAKAFLLNVLSQRLAIDVILSYIRHIF 250 Lactococcus lactis ...
CAD20391 174 IAFAAILLMIISIAGSLFLEQLVDIYIPHKNMDTLGIISICLIGAYLLQAVMTYFQNFLLTIFGQNLSRKIILNYINHLF 253 Lactobacillus sakei
CAA11805 168 TFIAAIIVLIIQIASTFYLQKIIDVYIPQKMNGTITIISLGMIIIYIYQQIFSFIQINSMNQLSQSLTSDIVLTYIKHVL 247 Carnobacterium dive...
P36497   253 DLPMNFFTTRHVGEMTSRFSDASKIIDALGSTTLTLFLDMWILLAVGLFLAYQNINLFLCSLVVVPIYISIVWLFKKTFN 332 Pediococcus acidila...
Q10418   256 ELPMSFFATRRTGEIVSRFTDANAIIEALASTMLSVFLDLGILVIVGTVLVVQNSTLFLISLIAIPAYALVVWLFMRPFS 335 Leuconostoc mesente...
Q00564   251 QLPMSFFSTRRTGEITSRFSDASSILDAIASTILSLFLDLTIVVMTGLILGLQNMQLFLLVLLAIPLYIVVIIIFTPLFE 330 Lactococcus lactis ...
CAD20391 254 ELPMSFFSTRRVGEIVSRFTDASKIIDALASTILTLFLDVWMLVTISIVLVFLNTKLFMISLVSIPVYSVIIYAFKNTFN 333 Lactobacillus sakei
CAA11805 248 KLPMSFFSTRRTGEIISRFTDVSSIVDAISSVIISIFLDMSMIIIVSFFLLRQNMLLFCLILLSIPVYAIIIISFFRPFK 327 Carnobacterium dive...
P36497   333 RLNQDTMESNAVLNSAIIESLSGIETIKSLTGEATTKKKIDTLFSDLLHKNLAYQKADQGQQAIKAATKLILTIVILWWG 412 Pediococcus acidila...
Q10418   336 KMNNDQMQAGSMLSSSIIEDINGVETIKALNSEATAYHKIDHEFVTYLEKSFVYAKTEAVQNAIKSLLQLSLNVVILWVG 415 Leuconostoc mesente...
Q00564   331 KQNHEVMQTNAVLNSSIIEDINGIETIKALASEQERYQKIDYEFASYLKKAFTLQKSEAIQGLIKAIIQLTLSVTILWFG 410 Lactococcus lactis ...
CAD20391 334 GLNHKSMENAALLNSAIIENVTGIETVKSLTSEEFSYNQITDRFENFLNSSLRYTIADQGQQALKVGLKLILIVFILWAG 413 Lactobacillus sakei
CAA11805 328 KLSTDAMQANSIMSSSIIEDLNGISTIKSLGVEDERFSKIESEFGDYLNKEFKNIQTRYVQMALKTVTNLILNVVVLWTG 407 Carnobacterium dive...
P36497   413 TFFVMRHQLSLGQLLTYNALLAYFLTPLENIINLQPKLQAARVANNRLNEVYLVESEFSKSREITALEQLNGDIEVNHVS 492 Pediococcus acidila...
Q10418   416 AQLVMTNKISVGQLITYNALLGFFTDPLQNIINLQTKLQQASVANNRLNEVYLVDSEFKDSHQMTEKITPNSSLVADHIT 495 Leuconostoc mesente...
Q00564   411 ATLVISQKITLGQLITFNALLSYFTNPITNIINLQTKLQKARVANERLNEVYLVPSEFEEKK--TELSLSHFNLNMSDIS 488 Lactococcus lactis ...
CAD20391 414 AIQVMRGNLTVGRLLAFNALVTYFLNPLENIINLQPKLQTARVANIRLNEVLLVDSEFNRGG-RDSSTNLNGDIVFQDVE 492 Lactobacillus sakei
CAA11805 408 SYLVITGKVTLGQVITFSLLISYFLTPLENIINLQPKLQAAKVAYNRLNEVYLVNGEEINKKK-SYTNNLLGDIQINKLS 486 Carnobacterium dive...
P36497   493 FNYGYCSNILEDVSLTIPHHQKITIVGMSGSGKTTLAKLLVGFFepQEQHGEIQINHHNISDISRTILRQYINYVPQEPF 572 Pediococcus acidila...
Q10418   496 YKYGFGAPAIDDVSLTITAGEKIALVGISGSGKSTLVKLLVNFF--QPESGTISLGPTPLANLDKHELRGHINYLPQEPF 573 Leuconostoc mesente...
Q00564   489 YQYGFGRKVLSEIELSIKENEKLTIVGMSGSGKSTLVKLLVNFF--QPTSGTITLGGIDLQQFDKHQLRRLINYLPQQPY 566 Lactococcus lactis ...
CAD20391 493 FSYGYGSNVLHNINIKIQKNSSTTIVGMSGSGKSTLAKLMVGFY--QAGSGQILLNGKLIDNIDRHALRQSITYVPQEPV 570 Lactobacillus sakei
CAA11805 487 YSYGLNDEILSDITLQIKMNSVTCLVGPSGSGKTTLAKLLVKFY--DARHGEILLNGFSLKDIDIGTLRQFINYLPQDPY 564 Carnobacterium dive...
P36497   573 IFSGSVLENLLLGSRPGVTQQMIDQACSFAEIKTDIENLPQGYHTRLSeSGFNLSGGQKQRLSIARALLSPAQCFIFDES 652 Pediococcus acidila...
Q10418   574 IFSGSIMENLLLGAKPGTTQEDIIRAVEIAEIKDDIEKMSQGFGTELA-ESGNISGGQKQRIALARAILVDSPVLILDES 652 Leuconostoc mesente...
Q00564   567 IFTGSILDNLLLGANENASQEEILKAVELAEIRADIEQMQLGYQTELSsDASSLSGGQKQRIALARALLSPAKILILDEA 646 Lactococcus lactis ...
CAD20391 571 MFAGTILENLIMQNKRNLSIDKVKEACRIAEIDKDIENFPMGYDTDISeHGSSISVGQKQRLSIARSLLTESNVLLFDES 650 Lactobacillus sakei
CAA11805 565 IFDGTILDNLLIGAKEKVEEDELWAVLDIVEIKDEIKKMPLGLQTSLSvENTTISGGQKQRIALARTLLTDSKVLVLDEV 644 Carnobacterium dive...
P36497   653 TSNLDTITEHKIVSKLLFMKDKTIIFVAHRLNIASQTDKVVVLDHGKIVEQGSHRQLLNYNGYYARLIHN 722 Pediococcus acidilactici
Q10418   653 TSNLDVLTEKKIIDNLMKLTEKTIIFVAHRLTISQRVDRILTMQSGKIIEDGTHDTLLKAGGFYASLFNH 722 Leuconostoc mesenteroides
Q00564   647 TSNLDMITEKKILKNLLPL-DKTIIFIAHRLSVAEMSHRIIVVDQGKVIESGSHVDLLAQNGFYEQLYHN 715 Lactococcus lactis subsp. lactis
CAD20391 651 TSSLDTITEQRIIENLLNLNDKTLIFVAHRLSVAKQTENIIVMDHGGIVETGSHDKLILENGYYKELCTV 720 Lactobacillus sakei
CAA11805 645 TSQLDLLLERKIVNNLVNIQHKTIIFIAHRLEVAKKSDKIIALSEGKVIEQGEYKELIDRKGFFYSLIHA 714 Carnobacterium divergens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap