Conserved Protein Domain Family
chvA

?
TIGR01192: chvA 
glucan exporter ATP-binding protein
This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 130260
View PSSM: TIGR01192
Aligned: 3 rows
Threshold Bit Score: 1057.57
Threshold Setting Gi: 116399
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB09036  47 VSLFRTYVRVLSYLNQEKNAFLLICTANITLAIITIAEPILFGHVIDTIADKSDTLVTLAVWMCFGISNIIAYVLVARGA 126 Bartonella bacillif...
P18767     1 MSLFQVYARALQYLAVHKFRVGAIVIANIVLAAITIAEPILFGRIIDAISSQKDVAPMLLLWAGFGVFNTIAFVLVSREA 80  Sinorhizobium melil...
P18768     1 MTLFQVYTRALRYLTVHKWRVAVVVIANVILAAITIAEPVLFGRIIDAISSGTNVTPILILWAGFGVFNTVAYVAVAREA 80  Agrobacterium tumef...
AAB09036 127 DRLAHRCRLTVLEKSFARIISMPLIWHQQRGTSHALHTLLRATDSMSSIWLEFMRQHLSTFVALFVLVPVTFKMNWRLSI 206 Bartonella bacillif...
P18767    81 DRLAHGRRASLLTEAFGRIVSMPLSWHSQRGTSNALHTLLRACETLFGLWLEFMRQHLATAVALMLLIPTAFAMDVRLSL 160 Sinorhizobium melil...
P18768    81 DRLAHGRRATLLTEAFGRIISMPLSWHHLRGTSNALHTLLRASETLFGLWLEFMRTHLATFVALVLLIPTAMAMDLRLSF 160 Agrobacterium tumef...
AAB09036 207 VLMVLAILYILIARLVMQKTKNGQAAVEHYHHNLFKHITDSISNVSIVQSYNRITEETSALHQHTNNLLSAQTPVLNWWA 286 Bartonella bacillif...
P18767   161 ILVVLGAAYVMISKVVMSRTKEGQAAVEGHYHTVFSHVSDSISNVSVVHSYNRIEAETRELKKFTQRLLSAQYPVLDWWA 240 Sinorhizobium melil...
P18768   161 VLIGLGIVYWFIGKWVMGRTKDGQASVEEHYHSVFAHVSDSISNVSVLHSYNRIEAETKALKSFTEKLLSAQYPVLDWWA 240 Agrobacterium tumef...
AAB09036 287 LASGLNRMASTISIVCVLLLGAFFVIKGQLSVGEVVTFVGFSQLMIGRLDQISGFINLAVSSQAKLQEFFDMEDSTFQTN 366 Bartonella bacillif...
P18767   241 LASGLNRIASTISMMAILVIGTVLVQRGELGVGEVIAFIGFANLLIGRLDQMKAFATQIFEARAKLEDFFQLEDSVQDRE 320 Sinorhizobium melil...
P18768   241 FASALNRTASTVSMMIILVIGTVLVKNGELRVGDVIAFIGFANLLIGRLDQMRQFVTQIFEARAKLEDFFVLEDAVKERE 320 Agrobacterium tumef...
AAB09036 367 EPANLPSLPNVKGAIQFHHVTYEFPNSSQGVFDISFEVKAGQTVAIVGPTGAGKTTLINLLQRVYDPTVGYISIDGININ 446 Bartonella bacillif...
P18767   321 EPADAGELKGVVGEVEFRDISFDFANSAQGVRNVSFKAKAGQTIAIVGPTGAGKTTLVNLLQRVHEPKHGQILIDGVDIA 400 Sinorhizobium melil...
P18768   321 EPGDARELSNVSGTVEFRNINFGFANTKQGVHDVSFTAKAGETVAIVGPTGAGKTTLINLLQRVYDPDSGQILIDGTDIS 400 Agrobacterium tumef...
AAB09036 447 SINRESLRKALATVFQDAGLFDRTIRDNISIGKTGATDEELYEATKTASAHDFILKKSKNYDTLVGERGSQLSGGERQRL 526 Bartonella bacillif...
P18767   401 TVTRKSLRRSIATVFQDAGLMNRSIGENIRLGREDASLDEVMAAAEAAAASDFIEDRLNGYDTVVGERGNRLSGGERQRV 480 Sinorhizobium melil...
P18768   401 TVTKNSLRNSIATVFQDAGLLNRSIRENIRLGRETATDAEVVEAAAAAAATDFIDSRINGYLTQVGERGNRLSGGERQRI 480 Agrobacterium tumef...
AAB09036 527 AIARAILKNAPILILDEATSALDVETEIRVKNAIDCISQNRTTFIIAHRLSTIRNADLVLFLDQGRLIEKGSFQELINKD 606 Bartonella bacillif...
P18767   481 AIARAILKNAPILVLDEATSALDVETEARVKDAIDALRKDRTTFIIAHRLSTVREADLVIFMDQGRVVEMGGFHELSQSN 560 Sinorhizobium melil...
P18768   481 AIARAILKNAPILVLDEATSALDVETEARVKAAVDALRKNRTTFIIAHRLSTVRDADLVLFLDQGRIIEKGTFDELTQRG 560 Agrobacterium tumef...
AAB09036 607 GHFYKLLKRGGLTINQPATKekddniiPLRKA 638 Bartonella bacilliformis
P18767   561 GRFAALLRASGILTDEDVRK-------SLTAA 585 Sinorhizobium meliloti 1021
P18768   561 GRFTSLLRTSGLLTEDEGQQ-------PRPKA 585 Agrobacterium tumefaciens str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap