Conserved Protein Domain Family
drrA

?
TIGR01188: drrA 
daunorubicin resistance ABC transporter ATP-binding subunit
This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130256
View PSSM: TIGR01188
Aligned: 8 rows
Threshold Bit Score: 436.821
Threshold Setting Gi: 669058781
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010877097  12 KVYGD--FKAVDSLNMKIEKNSIFGFLGPNGAGKTTTIKMLTCLIPPSSGTARVAGYDILKNPDEV--RQQIGMVPQKVS 87  Methanothermoba...
WP_009988331  13 KRFGK--FVAVDHINFEVYEGEIFGFLGPNGAGKSTTIKMLTTVLKPSEGTATVSGYDVIKQPALV--RQSIGVVPQEYT 88  Sulfolobus solf...
WP_010876717  12 KKYDE--FLAVKGVNLRVPEGSIYGVLGPNGAGKTTLISMLCTILRPTGGRGTVNGYDIVRDARKV--RESIGIVFQSRA 87  Methanothermoba...
P32010        16 KVYNG--TRAVDGLDLNVPAGLVYGILGPNGAGKSTTIRMLATLLRPDGGTARVFGHDVTSEPDTV--RRRISVTGQYAS 91  Streptomyces pe...
WP_030614054  22 KHYGE--TKALDGVDLDVREGTVMGVLGPNGAGKTTLVRILSTLITPDSGQATVAGYDVVRQPRQL--RRVIGLTGQYAS 97  Streptomyces ac...
WP_010879377  87 KKFGD--FEAVRGVSFKVKRGEIFAFLGPNGAGKTTTVHILTTLLKPTSGKAFVAGLDVVREAREV--RRRIGIVFQDPS 162 Archaeoglobus f...
WP_010884916  15 KYYGN--FPAVRGVTFSVNEGEVFGFLGPNGAGKTTTIRMLTGVLKPTSGQVRVLGYDMTREPEKLkaRQRMGIVPEMAN 92  Pyrococcus hori...
AIH36356       8 KTYGKgkIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTRPDAGSAIIAGYDVVSEPAGV--RRSIMVTGQQVA 85  Mycobacterium t...
WP_010877097  88 LYEDLTARENVEMCADFYGMPEDLKESRIEELMELVDIKYAADKPVGQMSGGQQQKVSLVASLIHQPDILFLDEPTIGLD 167 Methanothermoba...
WP_009988331  89 ADEDLTGWENMMMMAGLYGIPKRIAEERAKELLEMVELTYAAKRKVETYSGGMRRRLEIAMSLISRPRILFLDEPTLGLD 168 Sulfolobus solf...
WP_010876717  88 LDDILTGREHLEMHAALYGVPRDVRDRRIEEVLELIALGDKADEYVKTYSGGMKRRLEIGRGLIHHPRVLFLDEPTLGLD 167 Methanothermoba...
P32010        92 VDEGLTGTENLVMMGRLQGYSWARARERAAELIDGFGLGDARDRLLKTYSGGMRRRLDIAASIVVTPDLLFLDEPTTGLD 171 Streptomyces pe...
WP_030614054  98 VDEKLPGWENLYLIGRLLDLSRKEARARADELLERFSLTEAARRPAGTYSGGMRRRLDLAASMIGRPAVLYLDEPTTGLD 177 Streptomyces ac...
WP_010879377 163 VDRDLTAYENMLVHGGVYGLKGKELKEKIERLLKFVELWEFRDKLVKYFSGGMQRRLEIARSLLHHPEVLFLDEPTIGLD 242 Archaeoglobus f...
WP_010884916  93 PYIDLTAMQNLKLMGELYGLPKWEIEKRSIELLKLFELYEKRNIKVRGFSKGMRQRLVLAMAMIADPELYFLDEPTSGLD 172 Pyrococcus hori...
AIH36356      86 VDDALSGEQNLVLFGRLWGLSKSAARKRAAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLD 165 Mycobacterium t...
WP_010877097 168 PTTKRVLWDLIDELN-SS-GHTIILCSHDMYEVELLCDYVGIINQGVLAAFDTPQGLKdtvikeeeslrakeiggilDRI 245 Methanothermoba...
WP_009988331 169 AQTRAAIWQYIMKLK-EEyKMTIFVTTHYLEEADMYGDRIAIIDKGKILAIGSPKELK-------------------EKV 228 Sulfolobus solf...
WP_010876717 168 PQTRESIWRYIEKLNrEE-DVTVLLTTHYMEEADKLCDEVAIMSHGEIIKADSPGNLK-------------------REL 227 Methanothermoba...
P32010       172 PRSRNQVWDIVRALV-DA-GTTVLLTTQYLDEADQLADRIAVIDHGRVIAEGTTGELK-------------------SSL 230 Streptomyces pe...
WP_030614054 178 PRTRNEVWDEVKAMV-GD-GVTVLLTTQYMEEAEQLASELTVVDRGRVIAKGGIEELK-------------------ARV 236 Streptomyces ac...
WP_010879377 243 PQTRAHVWSYIEAMK-EEqDMTIFLTTHYMEEAEKLADRVAIIDHGRIIAEGSVEELK-------------------RLV 302 Archaeoglobus f...
WP_010884916 173 VISARIIKDIIRDEK-KA-GKTIFLTTHNMNDANELCERIGIIRKGKLVAIDTPEGLK--------------------RL 230 Pyrococcus hori...
AIH36356     166 PRSRQAIWDLVASFK-KL-GIATLLTTQYLEEADALSDRIILIDHGIIIAEGTANELK-------------------HRA 224 Mycobacterium t...
WP_010877097 246 DKETPeserraiqEIKksericagKEISMLIVNLTDDL-LsELEALPVTLDVKKHHTGriilELDETcetaVNDVLAAVI 324 Methanothermoba...
WP_009988331 229 GGDVV--------SLQ--------TSNDELAIKIISSSkD-GILDVRKASDGIRIKVR----NGEEK----APEILESLV 283 Sulfolobus solf...
WP_010876717 228 GADTIt--------VR--------VDRARGFHEILEKQ-D-YVKEAYLMDDEVKVLVE----RGENL----VPEIVNLAA 281 Methanothermoba...
P32010       231 GSNVLrlrlhdaqSRA--------EAERLLSAELGVT--------IHRDSDPTALSARi---DDPRQ----GMRALAELS 287 Streptomyces pe...
WP_030614054 237 GGRTLrvrpvdplQLR--------PLAGML-DELGITG-L---ASTTVDTETGALLVPi---LSDEQ----LTAVVGAVT 296 Streptomyces ac...
WP_010879377 303 GSDVVy--------LK--------VENG---AECFETG-L-G-NCVVLPDGRIRIDVS----NASEA----IPKIFEIAR 352 Archaeoglobus f...
WP_010884916 231 TKEH----------LS--------VEVSLKPMMFDPSV-LsSALRVERLGDKVKIYTN----DPDKT----VKEIVEYAK 283 Pyrococcus hori...
AIH36356     225 GDTFCeivprdlkDLD--------AIVAALGSLLPEHH----RAMLTPDSDRITMPAP----DGIRM----LVEAARRID 284 Mycobacterium t...
WP_010877097 325 RNNARITSISTKDPSLEDVFMKVTG 349 Methanothermobacter thermautotrophicus
WP_009988331 284 KNGIKVSRMSITEPTMDEVYMEFTG 308 Sulfolobus solfataricus
WP_010876717 282 RNNYYVRAVELEHPTLEDVFIKYTG 306 Methanothermobacter thermautotrophicus
P32010       288 RTHLEVRSFSLGQSSLDEVFLALTG 312 Streptomyces peucetius
WP_030614054 297 ARGITLSSITTELPSLDEVFLSLTG 321 Streptomyces achromogenes
WP_010879377 353 EKGVRILEVTYHRPTLNDVFLHLTG 377 Archaeoglobus fulgidus
WP_010884916 284 ERKLKIVSIRTLSPSLEDVFVEIIG 308 Pyrococcus horikoshii
AIH36356     285 EARIELADIALRRPSLDHVFLAMTT 309 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap