Conserved Protein Domain Family
potA

?
TIGR01187: potA 
spermidine/putrescine ABC transporter ATP-binding subunit
This model describes spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Polyamines like spermidine and putrescine play vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included). [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 162242
View PSSM: TIGR01187
Aligned: 6 rows
Threshold Bit Score: 507.802
Threshold Setting Gi: 586953417
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45171        41 ILGPSGCGKTTVLRLLAGLEELDSGSIILDGEDITNVPAEKRHINTVFQSYALFPHMTIFENVAFGLRMQKVPNEEIKPR 120 Haemophilus inf...
AAC27495      41 ILGPSGCGKTTVLRLLAGLEELDSGNIILDGEDITNVPAEKRHVNTVFQSYALFPHMTIFENVAFGLRMQKVPEAEIKPR 120 Aggregatibacter...
P23858        48 LLGPSGCGKTTVLRLIAGLETVDSGRIMLDNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPR 127 Escherichia coli
AAC12799       3 LLGSSGSGKTTLLMLLAGFDQPSEGKVLMSGTSVTEVPPHRRSIGVVFQNYALFPHMTAAENVAYPLKMRGVGRSERDER 82  Agrobacterium sp.
WP_001329149  77 LLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASR 156 Escherichia coli
AHK05203     108 LLGPSGSGKTTLLMTLAGFIRPDFGSLKFGEEEVILRAPHLRGVGMMFQNYALFPHMSVEANIAYPLKIRGEDRETIKAR 187 Agrobacterium t...
P45171       121 VLEALRMVQLEEMADRKPTQLSGGQQQRIAIARAVVNKPKVLLLDESLSALDYKLRKQMQQELKMLQRQLGITFIFVTHD 200 Haemophilus inf...
AAC27495     121 VLEALRMVQLEEMADRKPTQLSGGQQQRIAIARAVVNKPKVLLLDESLSALDYKLRKQMQYELKVLQRQLGITFIFVTHD 200 Aggregatibacter...
P23858       128 VMEALRMVQLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKLGITFVFVTHD 207 Escherichia coli
AAC12799      83 VKAALSLVNLTDRGASYPIQMSGGQQQRVALARSLVFGPDILLMDEPLGALDRRLRDQMQHELKRIQHELGITVIYVTHD 162 Agrobacterium sp.
WP_001329149 157 VNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHD 236 Escherichia coli
AHK05203     188 VRDVLETVQLGGYGSRRISELSGGQRQRIALARAIVFKPKILLMDEPLSALDKNLRELMQLELRTMHEQLGMTTVLVTHD 267 Agrobacterium t...
P45171       201 QEEAITMSDRIVLLRKGKIAQDGSPREIYEDPANLFVARFIGEINVFEATVIERKSEQVVLAN-VEGRICDIYTDMPVEK 279 Haemophilus inf...
AAC27495     201 QEEAITMSDRIVLLRKGKIAQDGSPREIYEEPANLFVARFIGEINVFDATVIERKSENVVLAN-VEGRVCDIYTDIPVKK 279 Aggregatibacter...
P23858       208 QEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFNATVIERLDEQRVRAN-VEGRECNIYVNFAVEP 286 Escherichia coli
AAC12799     163 QSEAMAMADRIGIMSGGELLQVADPETIYAAPSNHFVARFIGDCSILRVTNLDEGRGYEIAGG---------RQLLPSPA 233 Agrobacterium sp.
WP_001329149 237 QEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSpGLVHPLKVDADASVVD 316 Escherichia coli
AHK05203     268 QREALTMSDRIAVLRNGKIAQIDTSETLYSEPNSEFVAAFMGESS---FLTVEHDGASFCFHG-----RKLATESVTVEG 339 Agrobacterium t...
P45171       280 DQKLQVLLRPEDIVIEELDENEHSK--AIIGHIIDRTYKGMTLESTVEFDHNGMrVLVSEFFNEDDPHMD--HSIGQRVG 355 Haemophilus inf...
AAC27495     280 DQQLQVLLRPEDIVIKELDEHEHSK--AIIGHIIDRTYKGMTLESTVEFEQNGKrGLVSEFFNEDDPHMD--HSIGQRVG 355 Aggregatibacter...
P23858       287 GQKLHVLLRPEDLRVEEINDDNHAE--GLIGYVRERNYKGMTLESVVELE-NGKmVMVSEFFNEDDPDFD--HSLDQKMA 361 Escherichia coli
AAC12799     234 KTPFDIVVRPESVSIRSVAEANSDEgfAVPATIRDITYLGSGWRVALQISDGQS--LLANVMRGDLLAGS--LEPGKSVI 309 Agrobacterium sp.
WP_001329149 317 NVPVHVALRPEKIMLCEEPPANGCN--FAVGEVIHIAYLGDLSVYHVRLKSGQ---MISAQLQNAHRHRKglPTWGDEVR 391 Escherichia coli
AHK05203     340 ARRHLLVLRPEKLDFITERERSSYN--SFDGIVEKFLFQGESCLVHVRLTTG---ELVQVRRNLRESNKSvlPKVNDQVL 414 Agrobacterium t...
P45171       356 ITWHEGWEVVL 366 Haemophilus influenzae Rd KW20
AAC27495     356 ITWHEGWEVVL 366 Aggregatibacter actinomycetemcomitans Y4
P23858       362 INWVESWEVVL 372 Escherichia coli
AAC12799     310 ARWAPASVAVL 320 Agrobacterium sp.
WP_001329149 392 LCWEVDSCVVL 402 Escherichia coli
AHK05203     415 LGLHPNETRIV 425 Agrobacterium tumefaciens LBA4213 (Ach5)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap