Conserved Protein Domain Family
proV

?
TIGR01186: proV 
glycine betaine/L-proline transport ATP binding subunit
This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lactis functionally complements an E.coli proU mutant. The comlementing locus is similar to a opuA locus in B.sutlis. This clarifies the differences in nomenclature. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130254
View PSSM: TIGR01186
Aligned: 5 rows
Threshold Bit Score: 576.419
Threshold Setting Gi: 47831
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P14175        36 EKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSF 115 Escherichia col...
CAA36921      36 EKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSF 115 Salmonella ente...
Q45460        12 K--GGKKAVNNVNLKIAKGEFICFIGPSGCGKTTTMKMINRLIEPSAGKIFIDGENIMDQDPVEL----RRKIGYVIQQI 85  Bacillus subtil...
WP_003228346  13 vykGGKKAVNSIDLDIAKGEFICFIGPSGCGKTTTMKMINRLIEPSSGRIFIDGENIMEQDPVEL----RRKIGYVIQQI 88  Bacillus subtilis
WP_003234705  13 KATGSTVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQLREVRRKKISMVFQKF 92  Bacillus subtilis
P14175       116 ALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGL-ENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSA 194 Escherichia col...
CAA36921     116 ALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGL-ENYRHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSA 194 Salmonella ente...
Q45460        86 GLFPHMTIQQNISLVPKLLKWPEQQRKERARELLKLVDMgPEYVDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFGA 165 Bacillus subtil...
WP_003228346  89 GLFPHMTIQQNISLVPKLLKWPEEKRKERARELLKLVDMgPEYLDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFGA 168 Bacillus subtilis
WP_003234705  93 ALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGL-EGFEHQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSA 171 Bacillus subtilis
P14175       195 LDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVF 274 Escherichia col...
CAA36921     195 LDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVF 274 Salmonella ente...
Q45460       166 LDPITRDSLQEEFKKLQKTLHKTIVFVTHDMDEAIKLADRIVILKAGEIVQVGTPDDILRNPADEFVEEFIGKERLIQSS 245 Bacillus subtil...
WP_003228346 169 LDPITRDSLQEEFKKLQRTLNKTIVFVTHDMDEAIKLADRIVILKAGEIVQVGTPDEILRNPANEFVEEFIGKERLIQSR 248 Bacillus subtilis
WP_003234705 172 LDPLIRKDMQDELLDLHDNVGKTIIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVL 251 Bacillus subtilis
P14175       275 --SAKDIARRTPNGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLDAALIDAPLAVDA 352 Escherichia col...
CAA36921     275 --SAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGVVSIDSLKAALSQAQGIEAALIDDPLVVDA 352 Salmonella ente...
Q45460       246 spDVERVDQIMNTQPVTITADKTLSEAIQLMRQERVDSLLVVNDERVLQGYVDVEIIDQCRKKANLVSEVLHEDIYTVLG 325 Bacillus subtil...
WP_003228346 249 p-DIERVEQMMNRTPVTVSADKTLSQAIQLMREKRVDSLLVVDRQNVLKGYVDVEMIDQNRKKASIVGDVYRSDIYTVQK 327 Bacillus subtilis
WP_003234705 252 --TAGHIMKRAETVRI----DKGPRVALTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSLQDILNTEFTTVPE 325 Bacillus subtilis
P14175       353 QTPLSELLSHVGQAPCA-VPVVDEDQQYVGIISKGMLLRALD--REG 396 Escherichia coli K-12
CAA36921     353 QTPLSELLSHVGQAPCA-VPVVDEEHQYVGIISKRMLLQALD--REG 396 Salmonella enterica subsp. enterica serovar Typh...
Q45460       326 GTLLRDTVRKILKRGVKyVPVVDEDRRLIGIVTRASLVDIVYdsLWG 372 Bacillus subtilis subsp. subtilis str. 168
WP_003228346 328 GALLRDTVRKILKQGIKyVPVVDEQNHLAGIVTRASLVDIVYdsIWG 374 Bacillus subtilis
WP_003234705 326 NTYLTEIFDVVSDANIP-IAVVDEKQRMKGIVVRGALIGALAgnNEy 371 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap