Conserved Protein Domain Family
devC

?
TIGR01185: devC 
DevC protein
This model describes a predicted membrane subunit, DevC, of an ABC transporter known so far from two species of cyanobacteria. Some experimental data from mutational analysis suggest that this protein along with DevA and DevB encoded in the same operon may be involved in the transport/export of glycolipids. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130253
View PSSM: TIGR01185
Aligned: 3 rows
Threshold Bit Score: 715.14
Threshold Setting Gi: 499307079
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA18724       3 IPLAWHQLFHERMRLLAAIAGIAFADVLIFMQLGFKNALFDSAVRVPKSLQGDLFILSTQTDTFVNPTPFAARRLYQAMG 82  Synechocystis s...
CAA05976       6 IPLSWLQLTREKTRLAVALAGIAFADILMFMQIGFRDALYYSNVRLHTSLQGDIVLINKQSNAVLAMKPFSQRRLYKSLE 85  Anabaena variab...
WP_010997854   6 IPLSWLQLTREKTRLAVALAGIAFADILMFMQIGFRDALYYSNVRLHTSLQGDIVLLNKQSNAVLAMKPFSQRRLYKSLE 85  Nostoc sp. PCC ...
BAA18724      83 NASVKDGTSLYIDINRWKNPETKVSRQIYIMGFNPVNNPINLPGVAENLDLIKRPDVFLFDQDSREEFGPVPALLEADGP 162 Synechocystis s...
CAA05976      86 LPSVQSVHPIYLDYSIWKNPYTGLTRSILVFGINPETNILNLAGVQENLDKLKLPDAVLFDRSSRPEYGPIAKNFEQGQS 165 Anabaena variab...
WP_010997854  86 LPSVQSVHPIYLDYSIWKNPYTGLTRSILVFGINPETNIFNLAGVQENLDKLKLPDTVLFDRSSRPEYGPIAKNFEQGQS 165 Nostoc sp. PCC ...
BAA18724     163 VFTEVGNRRIQVQGLFTLGSSFGADGTLITSDLNFFRLFPNRDRSSIDAGILQLKPGADPEKVAEEIRQELTEgDVQVFT 242 Synechocystis s...
CAA05976     166 ISAEVRRRRINVVGLFTLGASFGADGNLVTSDVNFLRLFPLRRQGLIDIGLVRLKPGVNPNTAVQELRSYLPD-DINVLT 244 Anabaena variab...
WP_010997854 166 ISAEVRRRRINVVGLFTLGASFGADGNLVTSDVNFLRLFPLRRQGLIDIGLIRLKPGVNPNTAVQELRSYLPD-DINVLT 244 Nostoc sp. PCC ...
BAA18724     243 KEKLVQYELNYWQTRTTIGFVFGLGTAMGFIVGTVIVYQILYTDVSDHLPEYATLKAIGYGDRYLLGVVFQEALLLAVIG 322 Synechocystis s...
CAA05976     245 KQEFIDFERNYWASSTAIGFIFTLGTIMGFIVGTVIVYQILYTEVADHLSEYATLKAIGYTQKYLLGVILQEALLLACLG 324 Anabaena variab...
WP_010997854 245 KQEFIDFERNYWASSTAIGFIFTLGTIMGFIVGTVIVYQILYTEVADHLSEYATLKAIGYTQKYLLGVILQEALLLACLG 324 Nostoc sp. PCC ...
BAA18724     323 FLPSFGLGILLYTNTARATGLPLIMTTARALTVLIMTIAMCCISGAIAVGRLRAADPADIF 383 Synechocystis sp. PCC 6803
CAA05976     325 YLPGWVFAMVLYQTARQATLLPVFMSYDRAITVLILTMIMCFVSGSIAVRKLRSADPADIF 385 Anabaena variabilis ATCC 29413
WP_010997854 325 YLPGWIFAIILYKTARQATLLPVFMSYDRAITVLILTMIMCFVSGSIAVRKLRSADPADIF 385 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap