Conserved Protein Domain Family
ntrCD

?
TIGR01184: ntrCD 
nitrate transport ATP-binding subunits C and D
This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase. [Transport and binding proteins, Anions, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130252
View PSSM: TIGR01184
Aligned: 6 rows
Threshold Bit Score: 454.231
Threshold Setting Gi: 585583
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P38046    36 IEDVNLSVQQGEFICVIGHSGCGKSTLLNLVSGFSQPTSGGVYLDGQPIQEPGPDRMVVFQNYSLLPWKSARDNIALAVK 115 Synechococcus elong...
BAA05389  40 LDGVNLTVQEGEFICVIGHSGCGKSTLLNMVSGFNQPSHGSVRLKGKEIDRPGPDRMVVFQNYALLPWMTAYENVYLAVD 119 Synechococcus elong...
P73450    25 LKNIELKISQGEFISLIGHSGCGKSTLLNMISGLDKPTFGGVIMEGKEITEPGPERMVVFQNYSLLPWLTVRQNIALAVN 104 Synechocystis sp. P...
BAA05388  25 LKGIDLEIKQGEFISLIGHSGCGKSTLLNLIAGLELPTDGAVSLEGQQITAPGPDRMVVFQNYSLFPWLTVRENIALAVD 104 Synechococcus elong...
CAA79658  25 LKNIDLTIRKGEFVSLLGHSGCGKSTLLNIIAGLAKPAAGALILEGRQVTEPGPDRMVVFQNYSLLPWLTVRENIALAVN 104 Geitlerinema sp. PC...
P38045    25 LKDVSLNIRPGEFISLIGHSGCGKSTLLNLIAGLAQPSSGGIILEGRQVTEPGPDRMVVFQNYSLLPWRTVRQNIALAVD 104 Synechococcus elong...
P38046   116 AARPHLSTSEQRQVVDHHLELVGLTEAQHKRPDQLSGGMKQRVAIARALSIRPEVLILDEPFGALDAITKEELQEELLNI 195 Synechococcus elong...
BAA05389 120 CVNPQMREGEKREIVREHLAMVGLTEAAEKKITQISGGMKQRVAIARALSIRPEVLILDEPFGALDAITKEELQEELLKI 199 Synechococcus elong...
P73450   105 RVLRDLPKPEQEKIIDDNIALVGLQRAAHKRPGELSGGMKQRVAIARALSTRPKVLLLDEPFGALDALTRGNLQERLMEI 184 Synechocystis sp. P...
BAA05388 105 EVLRDLPKEERQAIVEEHIQLVGLGHAADKPPAQLSGGMKQRVAIARGLATRPKLLLLDEPFGALDALTRGNLQEKLMQI 184 Synechococcus elong...
CAA79658 105 RVMATASKSEREAIVEQHIDLVNLRHAADKRPGQLSGGMKQRVAIARALSIRPKLLLLDEPFGALDALTRSSLQDQLMQI 184 Geitlerinema sp. PC...
P38045   105 SVLHDRNRTERRTIIEETIDLVGLRAAADKYPHEISGGMKQRVAIARGLAIRPKLLLLDEPFGALDALTRGNLQEQLMRI 184 Synechococcus elong...
P38046   196 WEEARPTVLMITHDIDEALFLADRVVMMTNGPAATIGEVLEIPFDRPREREAVVEDPRYAQLRTEALDFL 265 Synechococcus elongatus PCC 7942
BAA05389 200 WNDHRCTVLMITHDIDEALFLADRLVMMTNGPAANIGEIMTIPFPRPRDRERIMEDPQYYDLRNYALDFL 269 Synechococcus elongatus PCC 7942
P73450   185 VQESGVTCIMVTHDVDEALLLSDRVVMLTTGPEAHIGQILEVPIPRPRHRLEVVNHPSYYALRGEMVYFL 254 Synechocystis sp. PCC 6803 su...
BAA05388 185 CEENHVTAVMVTHDVDEAVLLSDRIVMLTNGPGSKIGGILEVDIPRPRKRMDVVHHPSYYSLRSEIIYFL 254 Synechococcus elongatus PCC 7942
CAA79658 185 AEEHELTCIMVTHDVDEALLLSDRIVMLTNGPESYIGQIMDVPFERPRDRLEVVNDPSYYGMRSEIVYFL 254 Geitlerinema sp. PCC 8501
P38045   185 CQEAGVTAVMVTHDVDEALLLSDRVVMLTNGPAAQIGQILEVDFPRPRQRLEMMETPHYYDLRNELINFL 254 Synechococcus elongatus PCC 7942
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap