Conserved Protein Domain Family
ade

?
TIGR01178: ade 
adenine deaminase
The family described by this model includes an experimentally characterized adenine deaminase of Bacillus subtilis. It also include a member from Methanobacterium thermoautotrophicum, in which adenine deaminase activity has been detected. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
Statistics
?
PSSM-Id: 130246
View PSSM: TIGR01178
Aligned: 5 rows
Threshold Bit Score: 782.035
Threshold Setting Gi: 3912975
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O29999        25 DFVVKNAQIVDLVNEEIFEGDIAVAEGFIAGIGSYS-----------GVEECEASNLVAVPGLIDAHTHIEMSMLTVSEF 93  Archaeoglobus f...
P31441        31 DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYtd-------apALQRIDARGATAVPGFIDAHLHIESSMMTPVTF 103 Escherichia col...
Q58854         1 MIVFKNTKIIDVYTGEVVKGNVAVERDKISFVDLNDeidkiiekikeDVKVIDLKGKYLSPTFIDGHIHIESSHLIPSEF 80  Methanocaldococ...
O50821         2 DLFKIEANYIDIFNKEIYPASIAIANGHIASIEKIN----------------ATLDEYVLPGFIDAHIHIESSFLVPSNF 65  Borrelia burgdo...
WP_009968924  20 DIVIKNGKIMDVYNQEWIYEDIAITDGVIVGLGEYE-----------GENIIDAEGQMIVPGFIDGHVHIESSMVTPIEF 88  Bacillus subtilis
O29999        94 ARLVVPRGTTGVVADPHEIANVLGKDGVMLMLEEARSTPLRFYCMVPSCVPSS-P-LETSGARIGVEEIRELLEEEEVLG 171 Archaeoglobus f...
P31441       104 ETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVPAL-EgCDVNGASFTLEQMLAWRDHPQVTG 182 Escherichia col...
Q58854        81 EKFVLKSGVSKVVIDPHEIANIAGKEGILFMLNDAK--ILDVYVMLPSCVPAT-N-LETSGAEITAENIEELILLDNVLG 156 Methanocaldococ...
O50821        66 AHLVVAHGTVATISDPHEIANVNGIDGINFMINNSKKTEFKFFFGAPSCVPALsQeFETSGYVLNDKDIDELMKLDDIYY 145 Borrelia burgdo...
WP_009968924  89 AKAVLPHGVTTVVTDPHEIANVSGEKGIEFMLEQARHTPLNIHFMLPSSVPAA-S-FERSGAILKAADLKPFYEEEEVLG 166 Bacillus subtilis
O29999       172 LAEMMNFPGVVSADREVLEKIVLAG----IVDGHAPGLRGKKLNAYIAAGASSDHETTSFEEGKEKLRLGMWVMIREGSA 247 Archaeoglobus f...
P31441       183 LAEMMDYPGVISGQNALLDKLDAFRh--lTLDGHCPGLGGKELNAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSA 260 Escherichia col...
Q58854       157 LGEVMNYPAVINEDEEMLKKIEVAKkynkLIDGHCPKLKGWELNKYISHGIMSDHESVDEDEALEKLRLGLKLMIREGTA 236 Methanocaldococ...
O50821       146 LAEVMDFKGVINKDIEIINKINSALkrnkVVDGHAPGLSPNLTLKYASSGISTDHECLTIEDARYKLSLGMKILIREGSA 225 Borrelia burgdo...
WP_009968924 167 LAEVMDYVSVQQAEKDMVQKLLDARvagkRIDGHLAGLSTDLINIYRTAFVLNDHEVTSKEEALDRIRRGMYVMMREGSV 246 Bacillus subtilis
O29999       248 ARNLVALKGLT------GNRHTMLVTDgDRSVKDIIEEGYLDHVFRRAIEEG-IDEIKALQMLTLNPAEYFGIN-AGLIA 319 Archaeoglobus f...
P31441       261 ARNLNALAPLIne---fNSPQCMLCTD-DRNPWEIAHEGHIDALIRRLIEQHnVPLHVAYRVASWSTARHFGLNhLGLLA 336 Escherichia col...
Q58854       237 SKNIYLLNICKki---kDFRNIMLVSD---DVCIKDLDGYMLNILRKATNY--VSPIEAIQMVTINPANYFGFDvG--IK 306 Methanocaldococ...
O50821       226 AKNFESLHPLIsecskkYCDSLMFCFD-DAHPNDILN-GHINLIVARAIKHG-HDFFDVLKIACINPVLHYKIPvG-LLR 301 Borrelia burgdo...
WP_009968924 247 AKNTLNVLPAVne---kNRTPVFFCTD-DKHVDDLLSEGSVNHQVKMAIQAG-LNPFLAYQLGSLNAAECYGLDtKGAIA 321 Bacillus subtilis
O29999       320 PSRLADIVLLKNLRKFEVRDVFVGG----------RRPEFKRFNHPEWAKKTVKARKITPES---IQLKTG--RVRVIEV 384 Archaeoglobus f...
P31441       337 PGKQADIVLLSDARKVTVQQVLVKGepid--aqtlQAEESARLAQSAPPYGNTIARQPVSASdfaLQFTPGk-RYRVIDV 413 Escherichia col...
Q58854       307 AGNEASFVIFEDLDNFKVYNIVIKGrflddvlnelNKNKKRKIPEKLMNTLKYQYKNEGDFLikgIDYKERdgFIRVIKP 386 Methanocaldococ...
O50821       302 IGDPADFIITKDIKTFKINKTYINGkl-------vFNDGISLIPLINEIPINNFNCSKKSISd--FKFSTKnkMIPVIKC 372 Borrelia burgdo...
WP_009968924 322 PGFDADLLFVSDLENVTVTMTMVKGqtvaedskavYQDHASTAAPDQALLDSVKLAAPLNKQdfhMPIDSEq-QINVIQI 400 Bacillus subtilis
O29999       385 YDGEIVTG------EAIEEVQGVDVErDILKAVVVERHIRSGRVGKAYVRGFGLKRGAIAQSIAHDAHNIVCVGVDDGSI 458 Archaeoglobus f...
P31441       414 IHNELITHs----hSSVYSENGFDRD-DVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEM 488 Escherichia col...
Q58854       387 LKDSLITEel---iFSTEEIKILLNEnAINKIFVIERHKNTGNIGKGLIYNF-LEEGALASSYAHDSHNVIAIGNNEKDL 462 Methanocaldococ...
O50821       373 ISNQIITHktmidsNLLAPDFQSNIAeDILKIAIINRYKDNSKISIGFIKNFGIRNGAIGSTVAHDSHNIILVGSNDEYL 452 Borrelia burgdo...
WP_009968924 401 IPNQLETRlvq-vpAPVAREFEPDTElDLLKIAVVERHKGLKETGLGVVKGFGFKSGAIATTISHDSHNIIAVGTNDEDI 479 Bacillus subtilis
O29999       459 CAAVNRVIELQGGIVVA-DAEVRAELPLPIAGIMSDERAERVLERLSEIEEEVRKLGCRL-KSPVITLSFIALPVIPKLK 536 Archaeoglobus f...
P31441       489 ALAVNQVIQDGGGLCVVrNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLP-DEPFIQMAFLSLPVIPALK 567 Escherichia col...
Q58854       463 ALAVNKLKDIGGGFIAAkDGEVVEYLPLPVGGIMGDD-GKYIAEKINALYKKIEGWSSFE--NPFLSMSFFSLPVIPELK 539 Methanocaldococ...
O50821       453 CKAANTIIQNKGGLCAL-NNEKTIIMELPISGLMSTLSAERVASQYIKLNDFCKNVLGSRlDDPLMTLSFMSLTVVPHLK 531 Borrelia burgdo...
WP_009968924 480 AAAVNKLQEIGGGLTIIkNGEELHSVPLPIAGLLSDQSAEQVNQSLLTLHDKLSLIGFTGgFNPFLTLSFLALPVIPDIK 559 Bacillus subtilis
O29999       537 LTDLGLVDVEAFRVVDL 553 Archaeoglobus fulgidus DSM 4304
P31441       568 LTSQGLFDGEKFAFTTL 584 Escherichia coli K-12
Q58854       540 ITDKGLVKDMQLVDLFI 556 Methanocaldococcus jannaschii DSM 2661
O50821       532 INDKGLFDVDSFCFVDY 548 Borrelia burgdorferi B31
WP_009968924 560 MTTTGLFDVKSFQHISL 576 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap