Conserved Protein Domain Family
cbiO

?
TIGR01166: cbiO 
cobalt transport protein ATP-binding subunit
This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130234
View PSSM: TIGR01166
Aligned: 6 rows
Threshold Bit Score: 304.731
Threshold Setting Gi: 2808786
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA16215      24 YEEGPDVLTGLDFAVREGRALALLGRNGSGKTTLMRLLSGGLKPHTGTLTLGGEPVAYDRKGLTRLRTTVQLVVQDPDDQ 103 Streptomyces co...
AAC16196      14 FPGGVKALDDLSLAVPQGESLAILGPNGAGKSTLLLHLNGTLRPQSGRVLLGGTATGHSRKDLTDWRRRVGLVLQDADDQ 93  Rhodobacter cap...
AAA78896      14 FPDRPRVLDTVNLAIGRGTRLALLGANGSGKTTLLSCLAGSLKPTGGAVERDGAPIDWGRKGLREHRRHVQMVLQDPDDQ 93  Propionibacteri...
AAA27267      11 YQNEP-VLKGLNMDFSLSPVTGLVGANGCGKSTLFMNLSGLLRPQKGAVLWQGKPLDYSKRGLLARRQQVATVFQDPEQQ 89  Salmonella ente...
WP_010875772  15 YPDGTEALRGINFHAERGEVVALLGPNGAGKSTLFLHFNGILQPTSGKIMIDGEELDYSKSGLIKARQKVGIVFQNPDDQ 94  Methanothermoba...
WP_010878234  43 cyGDAEVLKGVNFKAERGKVTVLMGRNGAGKTTLLKHLNGLLRPKSGKVIIDGRELKYDRKSLLEVRKRVFYVFQNPDDQ 122 Archaeoglobus f...
CAA16215     104 LFAASVGQDVSFGPLNLGLSDAEVRSRVGEALAALDISGLAERPTHLLSYGQRKRTAIAGAVAMRPRVLILDEPTAGLDP 183 Streptomyces co...
AAC16196      94 LFAATVFEDVSFGPLNLGLSEAEARARVEEALAALSISDLRDRPTHMLSGGQKRRVAIAGAVAMRPEVLLLDEPTAGLDL 173 Rhodobacter cap...
AAA78896      94 LFSADVSQDVSFGPMNLGLEPDEVHARVREALTLLGADHLAERATHQLSYGERKRVATAGAVAMRPDVLMLDEPTAGLDP 173 Propionibacteri...
AAA27267      90 IFYTDIDSDIAFSLRNLGGPEAEITRRVDEALTLVDAQHFRHQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLDP 169 Salmonella ente...
WP_010875772  95 LFAPRVDEDVAFGPLNMGLSEDEVEERVRDALQKVGMLGYESKPPHHFSGGEKKRVAIAGIIAMKPDIMVLDEPTSGLDP 174 Methanothermoba...
WP_010878234 123 ILSPTVWQDVAFGPRNLGLKGERLERVVRNALEAVGLSGYEKRLCSTLSGGEKRRLAIASALAMNPDYCIMDEPSANVDG 202 Archaeoglobus f...
CAA16215     184 DGQERLLATLDGLRAGGTTVVMATHDVDLA 213 Streptomyces coelicolor A3(2)
AAC16196     174 AGTEQLLTLLHGLRAAGMTLVFSTHDVELA 203 Rhodobacter capsulatus SB 1003
AAA78896     174 LGVHQMRDALDRLTDAGTTIVMATHDVALA 203 Propionibacterium freudenreichii subsp. shermanii
AAA27267     170 AGRTQMIAIIRRIVAQGNHVIISSHDIDLI 199 Salmonella enterica subsp. enterica serovar Typhimurium
WP_010875772 175 RGASQILRLLHNLNEEGMTIIISTHDVDLA 204 Methanothermobacter thermautotrophicus
WP_010878234 203 EGLRMIAEIIRKLREEGKGVVVSTHDADLA 232 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap