2OGH,2IF1


Conserved Protein Domain Family
SUI1_MOF2

?
TIGR01160: SUI1_MOF2 
Click on image for an interactive view with Cn3D
translation initiation factor SUI1, eukaryotic
Alternate name: MOF2. A similar protein family (see TIGRFAMs model TIGR01158) is found in prokaryotes. The human proteins complements a yeast SUI1 mutatation. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 130228
View PSSM: TIGR01160
Aligned: 6 rows
Threshold Bit Score: 174.636
Threshold Setting Gi: 7404466
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OGH_A     2 SIENLKSFDPFADTGDDETA----TSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEI 77  Saccharomyces cerev...
P32911     2 SIENLKSFDPFADTGDDETA----TSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEI 77  Saccharomyces cerev...
P41568     5 DSQVPTAFDPFADANAEDSGa--gTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDSELGQV 82  thale cress
AAF76883   4 EVHNFGISDPFANDTSQFSVgg-sTTHLIHIRNQQRNGRKXVTTVQGLDKALDLKKMVRALKKELNCNGTVIEDAEHGSV 82  Neospora caninum
P48024     3 AIQNLHSFDPFADASKGDDLlpagTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEV 82  house mouse
2IF1_A    16 AIQNLHSFDPFADASKGDDLlpagTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEV 95  human
2OGH_A    78 IQLQGDQRAKVCEFMISQLGLQKKNIKIHGF 108 Saccharomyces cerevisiae S288c
P32911    78 IQLQGDQRAKVCEFMISQLGLQKKNIKIHGF 108 Saccharomyces cerevisiae S288c
P41568    83 IQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 thale cress
AAF76883  83 IQLQGDQRHAVKEFLEREDICSGEQIRIHGA 113 Neospora caninum
P48024    83 IQLQGDQRKNICQFLIEIGLAKDDQLKVHGF 113 house mouse
2IF1_A    96 IQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 126 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap