Conserved Protein Domain Family

TIGR01160: SUI1_MOF2 
Click on image for an interactive view with Cn3D
translation initiation factor SUI1, eukaryotic
Alternate name: MOF2. A similar protein family (see TIGRFAMs model TIGR01158) is found in prokaryotes. The human proteins complements a yeast SUI1 mutatation. [Protein synthesis, Translation factors]
PSSM-Id: 130228
Aligned: 6 rows
Threshold Bit Score: 174.636
Threshold Setting Gi: 7404466
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
2OGH_A    78 IQLQGDQRAKVCEFMISQLGLQKKNIKIHGF 108 Saccharomyces cerevisiae S288c
P32911    78 IQLQGDQRAKVCEFMISQLGLQKKNIKIHGF 108 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap