2RCR


Conserved Protein Domain Family
pufL

?
TIGR01157: pufL 
Click on image for an interactive view with Cn3D
photosynthetic reaction center L subunit
This model describes the photosynthetic reaction center L subunit in non-oxygenic photosynthetic bacteria. Reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in form of NADH. Ultimately the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is some organic acid and not water. Much of our current functional understanding of photosynthesis comes from the structural determination, spectroscopic studies and mutational analysis on the reaction center of Rhodobacter sphaeroides. [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130225
View PSSM: TIGR01157
Aligned: 7 rows
Threshold Bit Score: 374.908
Threshold Setting Gi: 6690736
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2RCR_L        34 FGVATFFFAALGIILIAWSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALREVEICRKLGI 113 Rhodobacter sph...
AAA26174      35 FGVTTIFFATLGFLLILWGAAMQGTWNPQLISIFPPPVENGLNVAALDKGGLWQVITVCATGAFCSWALREVEICRKLGI 114 Rhodobacter cap...
AAF24304      35 FGVATFFFAALGIILIAWSAELQGSWNPQLIFVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALREVEICRKLGI 114 Rhodobacter sph...
BAA22797      35 FGVTTVFFTLLGVALIVLAASHGPTWNPWEISIAPPDLSYGLGFAPLNEGGFWQFITICATGAFVSWALRQVEIARKLGM 114 Phaeospirillum ...
BAA32993       1 FGVTTAISAALGTMLIFAAALEGPTMNPWLIDIQPPAIEEGLSIMPLKEGGYWQWITVCALIAFSSWVMRQAEISRKLGM 80  Erythrobacter s...
WP_011390723  35 FGVTTLLFTVLGTALIVWGAALGPSWTFWQISINPPDVSYGLAMAPMAKGGLWQIITFSAIGAFVSWALREVEICRKLGI 114 Rhodospirillum ...
BAA33001      35 FGVTAVFCALMGTALIIWNTALGPTWNLWQISVNPPDAKYGLGFAPLAEGGIWQWVTIFATGAFCSWALREVEICRKLGI 114 Rhodopseudomona...
2RCR_L       114 GYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGAL 193 Rhodobacter sph...
AAA26174     115 GFHIPVAFSMAIFAYLTLVVIRPMMMGSWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPFHMLGISLFFTTAWALAMHGAL 194 Rhodobacter cap...
AAF24304     115 GYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGAL 194 Rhodobacter sph...
BAA22797     115 GLHVPFAFSFAILAYVTLVVIRPVLMGAWGYGFPYGIFSHLDWVSNVGYQFLHFHYNPAHMIAISFFFTNALALAMHGGL 194 Phaeospirillum ...
BAA32993      81 TYHVPIAFATAVFAYFTLQVIRPVWMGAWGHAFPYGIWTHLDWVSYTGYLYGNFHFNPIHMLAITFFFTNCLALALHGGL 160 Erythrobacter s...
WP_011390723 115 GYHIPFAFGFAILAYVSLVVIRPVMMGAWGYGFPYGFMTHLDWVSNTGYQYANFHYNPAHMLGITLFFTTCLALALHGSL 194 Rhodospirillum ...
BAA33001     115 GYHVPFAFSFAIFAYLTLVVIRPVLMGSWSYGFPYGIFTHLDWVSNTGYQYGQFHWNPGHMIAITFFFTTCLALALHGGL 194 Rhodopseudomona...
2RCR_L       194 VLSAANPEKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMIITGTIWFDQ--WVDWWQWWVKLPW 271 Rhodobacter sph...
AAA26174     195 VLSAANPVKGKTMRTPDHEDTYFRDLMGYSVGTLGIHRLGLLLALNAVFWSACCMLVSGTIYFDL--WSDWWYWWVNMPF 272 Rhodobacter cap...
AAF24304     195 VLSAANPEKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMIITGTIWFDQ--WVDWWQWWVKLPW 272 Rhodobacter sph...
BAA22797     195 ILSASNPGKGEVVKAAEHEDTFFRDVVGYSSGALAIHRIGLFLAISAAFWSAVCIVISGPFWTRG--WPEWWGWWLNLPV 272 Phaeospirillum ...
BAA32993     161 VLSAVNPSGDTEVKTPEYEDTYFRDFIGYSVGTLGIHRVGLFLALNAGFWSAICIVISGPIYAGS--WVDFWEFWREIPL 238 Erythrobacter s...
WP_011390723 195 ILSAANPGKGEVVKGPEHENTYFQDTIGYSVGTLGIHRVGLILALSAVVWSIICMILSGPIYTGS--WPDWWLWWQKLPF 272 Rhodospirillum ...
BAA33001     195 VLSAINPDRGEPVKSPEHENTVFRDLVGYSIGTIGIHRVGLFLALSAVFWSAVCMLISGPVLPEGgsWPEWWEWWRRIPI 274 Rhodopseudomona...
2RCR_L       272 W 272 Rhodobacter sphaeroides
AAA26174     273 W 273 Rhodobacter capsulatus
AAF24304     273 W 273 Rhodobacter sphaeroides
BAA22797     273 W 273 Phaeospirillum molischianum
BAA32993     239 W 239 Erythrobacter sp. MBIC3361
WP_011390723 273 W 273 Rhodospirillum rubrum
BAA33001     275 W 275 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap