1Q90


Conserved Protein Domain Family
cytb6/f_IV

?
TIGR01156: cytb6/f_IV 
Click on image for an interactive view with Cn3D
cytochrome b6/f complex subunit IV
This model describes the subunit IV of the cytochrome b6/f complex. The cyt b6/f complex is central to the functions of the oxygenic phosynthetic electron transport in cyanobacteria and its equivalents in algae and higher plants. Energetically, on the redox scale the cytb6/f complex is placed below the other components - Q(A); Q(B) of the photosystem II in the Z-scheme, along the pathway of the electron transport. The complex is made of the following subunits: cytochrome f; cytochrome b6; Rieske 2Fe-2S; and subunits IV; V; VI; VII. Subunit IV is one of the principal subunits for the binding of the redox prosthetic groups. Each monomer of the complex contains a molecule of chlorophyll a and beta-carotene. [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130224
View PSSM: TIGR01156
Aligned: 12 rows
Threshold Bit Score: 263.196
Threshold Setting Gi: 129866
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q90_D     1 MSVTKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWY 80  Chlamydomonas reinh...
P28059     1 MSVLKKPDLTDPVLLEKLAQNMGHNYYGEPAWPNDLLYTFPVVILGTLACVVGLAVLDPAMVGEPANPFATPLEILPEWY 80  Prochlorothrix holl...
P06249     1 MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWY 80  common tobacco
P12118     1 MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWY 80  Oryza sativa
P00166     1 MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWY 80  spinach
P06250     1 MGVTKKPDLSDPILRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPSMIGEPANPFATPLEILPEWY 80  liverwort
AAD54784   1 MSVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTLSCITGLAVLDPAAIGEPANPFATPLEILPEWY 80  Nephroselmis olivacea
P56322     1 MAVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTFACVIGLSVLDPAAIGEPANPFATPLEILPEWY 80  Chlorella vulgaris
P48122     1 MSILKKPDLNDPELRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGSIACCGGLAVLDPALIGEPADPFSTPLEILPEWY 80  Cyanophora paradoxa
CAB72243   1 MATQKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWY 80  Anabaena variabilis
P27589     1 MSIIKKPDLSDPDLRAKLAKGMGHNYYGEPAWPNDILYMFPICILGALGLIAGLAILDPAMIGEPADPFATPLEILPEWY 80  Synechocystis sp. P...
Q54710     1 MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDPALVGEPADPFATPLEILPEWY 80  Synechococcus elong...
1Q90_D    81 FYPVFQILRVVPNKLLGVLLMAAVPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGL 159 Chlamydomonas reinha...
P28059    81 LYPAFQILRVVPNKLLGILLQTAIPLGLMLVPFIENINKFQNPFRRPIAMAVFLFGTLVTLWMGVAATLPIDKFFTLGL 159 Prochlorothrix holla...
P06249    81 FFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGL 159 common tobacco
P12118    81 FFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGL 159 Oryza sativa
P00166    81 FFPVFQILRTVPNKLLGVLLMASVPAGLLTVPFLENVNKFQNPFRRPVATTVFLVGTVVALWLGIGATLPIDKSLTLGL 159 spinach
P06250    81 FFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTVVALWLGIGAALPIDKSLTLGL 159 liverwort
AAD54784  81 FFPVFQLLRTVPNKLLGVLLMAAVPAGLLTVPFIESINKFQNPFRRPVATTVFLIGTVVAIWLGIGATLPIDISLTLGL 159 Nephroselmis olivacea
P56322    81 FYPVFQILRVVPNKLLGVLLMAAVPAGLLTVPFIENINKFQNPFRRPVATTVFLIGTVAAIWLGIGAALPIDISLTLGL 159 Chlorella vulgaris
P48122    81 FFPVFQILRVIPNKLLGVVLMAAVPAGLIAVPFIENVNKFQNPFRRPVASAVFLFGTFVAIWLGIGATFPIDKSLTLGL 159 Cyanophora paradoxa
CAB72243  81 LYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGL 159 Anabaena variabilis
P27589    81 LYPTFQILRILPNKLLGIAGMAAIPLGLMLVPFIESVNKFQNPFRRPIAMTVFLFGTAAALWLGAGATFPIDKSLTLGL 159 Synechocystis sp. PC...
Q54710    81 LYPVFQILRIVPNKLLGIVLQSMIPLGLIAIPFIESVNKFQNPFRRPIATAVFLFGTVFTLYLGIGAALPIDKSLTLGL 159 Synechococcus elonga...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap