1W5C


Conserved Protein Domain Family
psbA

?
TIGR01151: psbA 
Click on image for an interactive view with Cn3D
photosystem II, DI subunit (also called Q(B))
This model describes the Photosystem II, DI subunit (also called Q(B)) in bacterial and its equivalents in chloroplast of algae and higher plants. Photosystem II is many ways functionally equivalent to bacterial reaction center. At the core of Photosystem II are several light harvesting cofactors including plastoquinones, pheophytins, phyloquinones etc. These cofactors are intimately associated with the polypeptides, which principally including subunits DI, DII, Cyt.b, Cyt.f and iron-sulphur protein. Together they participate in the electron transfer reactions that lead to the net production of the reducting equivalents in the form of NADPH, which are used for reduction of CO2 to carbohydrates(C6H1206). Phosystem II operates during oxygenic photosynthesis and principal electron donor is H2O. Although no structural data is presently available, a huge body of literature exits that describes function using a variety of biochemical and biophysical techniques. [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130221
View PSSM: TIGR01151
Aligned: 21 rows
Threshold Bit Score: 698.612
Threshold Setting Gi: 1346838
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W5C_A         1 MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG 80  Synechococcus e...
P51765         1 MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG 80  Thermosynechoco...
P04997         1 MTTALQRRESASLWQQFCEWVTSTDNRLYVGWFGVLMIPTLLTATICFIVAFIAAPPVDIDGIREPVAGSLMYGNNIISG 80  Synechococcus e...
P51759         1 MTTTLQQRESVSLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIVSG 80  Cyanothece sp. ...
P51764         1 MTTTLQQRESASLWEQFCQWITSTNNRLYVGWFGVIMIPTLLTATTCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80  Microcystis aer...
P07063         1 MTTTLQQRSRASVWDRFCEWITSTENRIYIGWFGVLMIPTLLAATACFVIAFIAAPPVDIDGIREPVAGSLIYGNNIISG 80  Microchaete dip...
P29270         1 MTTTLQQRSTANVWDRFCEWITSTENRIYIGWFGVLMIPTLVSAIACFVIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80  Trichormus azollae
P31694         1 MTATLQQRKSANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAAPPVDIDGIREPVAGSLIYGNNIISG 80  Nostoc sp. PCC ...
P56318         1 MTAILERRESASLWARFCEWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISG 80  Chlorella vulgaris
WP_010871214   1 MTTTLQQRESASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG 80  Synechocystis s...
1W5C_A        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI 160 Synechococcus e...
P51765        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI 160 Thermosynechoco...
P04997        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFLIGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLI 160 Synechococcus e...
P51759        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFLIGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLI 160 Cyanothece sp. ...
P51764        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFLLGVFCYLGRQWELSFRLGMRPWICVAYSAPVSAATAVFLI 160 Microcystis aer...
P07063        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFLLGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLI 160 Microchaete dip...
P29270        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFLIGVACYLGREWELSYRLGMRPWICVAFSAPVAAATAVFLI 160 Trichormus azollae
P31694        81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFLTGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLI 160 Nostoc sp. PCC ...
P56318        81 AIIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFFLGICSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFII 160 Chlorella vulgaris
WP_010871214  81 AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFLIGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLI 160 Synechocystis s...
1W5C_A       161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG 240 Synechococcus e...
P51765       161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG 240 Thermosynechoco...
P04997       161 YPIGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG 240 Synechococcus e...
P51759       161 YPIGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNYGYKFG 240 Cyanothece sp. ...
P51764       161 YPIGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNYGYKFG 240 Microcystis aer...
P07063       161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILLHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG 240 Microchaete dip...
P29270       161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG 240 Trichormus azollae
P31694       161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNYGYKFG 240 Nostoc sp. PCC ...
P56318       161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG 240 Chlorella vulgaris
WP_010871214 161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFG 240 Synechocystis s...
1W5C_A       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI 320 Synechococcus e...
P51765       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI 320 Thermosynechoco...
P04997       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTSLGISTMAFNLNGFNFNQSVLDSQGRVINTWADV 320 Synechococcus e...
P51759       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVIGIWFTAMGVSTMAFNLNGFNFNQSILDSQGRVIGTWADV 320 Cyanothece sp. ...
P51764       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGFNFNQSILDSQGRVIGTWVDV 320 Microcystis aer...
P07063       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGFNFNQSVIDSQGRVIATWADV 320 Microchaete dip...
P29270       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGVSTMAFNLNGFNFNQSIIDSQGRVIGTWADV 320 Trichormus azollae
P31694       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGFNFNQSIIDSQGRVINTWADI 320 Nostoc sp. PCC ...
P56318       241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320 Chlorella vulgaris
WP_010871214 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGFNFNQSILDSQGRVIGTWADV 320 Synechocystis s...
1W5C_A       321 INRANLGMEVMHERNAHNFPLDLASAESAPVAMIAPSING 360 Synechococcus elongatus
P51765       321 INRANLGMEVMHERNAHNFPLDLASAESAPVAMIAPSING 360 Thermosynechococcus vulcanus
P04997       321 LNRANLGMEVMHERNAHNFPLDLAAGEATPVALTAPAING 360 Synechococcus elongatus PCC 7942
P51759       321 LNRAGIGMEVMHERNAHNFPLDLASAEP----VSAPVING 356 Cyanothece sp. ATCC 51142
P51764       321 LNRAGIGMEVMHERNAHNFPLDLASGEQAPVALTAPAING 360 Microcystis aeruginosa
P07063       321 INRANLGMEVMHERNAHNFPLDLAAGEVAPVALTAPAING 360 Microchaete diplosiphon
P29270       321 INRANLGMEVMHERNAHNFPLDLAAGDVAPVALTAPPING 360 Trichormus azollae
P31694       321 INRANLGMEVMHERNAHNFPLDLAAGEVAPVAISAPAING 360 Nostoc sp. PCC 7120
P56318       321 INRANLGMEVMHERNAHNFPLDLA-------VVEAPAVNG 353 Chlorella vulgaris
WP_010871214 321 LNRANIGFEVMHERNAHNFPLDLASGEQAPVALTAPAVNG 360 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap