Conserved Protein Domain Family
mtrG

?
TIGR01149: mtrG 
N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G
This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit G in methanogenic archaea. This methyltranfersae is membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 130219
View PSSM: TIGR01149
Aligned: 5 rows
Threshold Bit Score: 98.6274
Threshold Setting Gi: 668978
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA59002  4 EEKttIPRVLVSADEFNKANEKLDEIEEKVEFTVGEYSQRIGQQIGRDIGILYGIVIGLIILAVTNILFAGL 75  Methanothermobacter thermaut...
CAB41644  2 DGK--APAAFVEPGEFNEVMKRLDKIDEKIEFVNSEVAQKIGKKVGRDIGILYGGFIGLLLFLIYTVVSSMF 71  Methanosarcina barkeri
P80656    2 DGK--APAAFVEPGEFNEVMKRLDQIDEKVEFVNSEVAQRIGKKVGRDIGILYGGVIGLLLFLIYVQISSMF 71  Methanosarcina mazei Go1
Q58263    4 DEK--LPQVIMDPADYEALKKRLDELEKKVENTNAELFQLAGKKVGRDIGILYGLVIGIILSYILPALIKII 73  Methanocaldococcus jannaschi...
O32868    4 EES--VPKMVAPEDDIREIHSRLDEIERRLDFVWGEVYQRFGKRIGRDIGILYGLVIGLYLCMLYILLGVAF 73  Methanopyrus kandleri AV19
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap