Conserved Protein Domain Family
mtrC

?
TIGR01148: mtrC 
N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit C
This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit C in methanogenic archaea. This methyltranferase is membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 130218
View PSSM: TIGR01148
Aligned: 5 rows
Threshold Bit Score: 312.487
Threshold Setting Gi: 312122
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O59638     1 MSAGGAGGEAKGAYPQQTLMALGIVGG-LVGIYLGHFMPPAYS--FFGGIGAICATVWGADAVRRVASYGLGTGVPSIGM 77  Methanosarcina maze...
CAB41640   1 MSAGGAGGEAKGGYPPQTIMALGIVGG-LVGIYLGNFAPPAYS--FFGGLGAICATDWGADAVRRVASYGLGTGVPSIGM 77  Methanosarcina barkeri
Q58259     1 MSHGG-GGHAAELYPEEQIFAVGIALS-LVGCYLANFLSPYGLgmLIGGLLASAACVAGANTVRKVAAYGLGTGVPSIGM 78  Methanocaldococcus ...
CAA51554   1 MSVAA-GGPAGAAIPESRLMALGILGG-LAGIYASAVNPVIGP--VLASLGAVCAIVWGADAIRRVASYGLGTGVPSIGY 76  Methanothermobacter...
O32865     8 ISAVAPGGEEEEVEVAVAISPLKLMTAgLICGILGTAFAWVHP--LIPALAVIPVVVWGADAVRRVAGYGLGTGVPSIGF 85  Methanopyrus kandle...
O59638    78 LALGMGILAALFGLALGG------IAGPILAVVVAAIIGGVIGALANKVIGMGIPIMEQAMIEISCAGTLVILGLSVVIA 151 Methanosarcina maze...
CAB41640  78 LALGMGILAALFGLSVGG------TAGPIVAIVVAAIIGGVIGALANKVIGMGIPIMEKAMVEISCAGTLVILGLSVVIA 151 Methanosarcina barkeri
Q58259    79 VSLGMGTLAAVAGVLIPDyfnlpyLVAPIITLIVSAVIGYIVGRLTVNPVGMKIPIMVRSMTFLSIAGAMALLGFTVAYV 158 Methanocaldococcus ...
CAA51554  77 MSVSIGIVGVVAGLASVFvv--paIAVPVVALILAMILGVVVAVLGKKIVKMKIPILEKCTAEISGAAALSVLGFSAAIA 154 Methanothermobacter...
O32865    86 MGLGGGSVAAILAAALSGntv-paWAAAIIGTVIGAVVGALLGVLDRRVIKMKIPVMERCSTEIVASGTLALICLMAAVA 164 Methanopyrus kandle...
O59638   152 GSFDYAAIIENVIANGYIALIFIIGGMGILHPFNACLGPDESQDRTLILAVEKAaialIITGFASSLHEGLMTAG--INI 229 Methanosarcina maze...
CAB41640 152 GSFDFASVVQYVVANGYIALIFIIGGMGILHPFNASLGPDEKQDRTLMLAVEKGaialIIAGFASSLHEGLMAAG--LNM 229 Methanosarcina barkeri
Q58259   159 GSLEPQKYIDYALNNGMMALAFIAAGMAILHPFNACLGPNESHKRTLTLAVACG----FITWFVFSVVKLDIVS-----I 229 Methanocaldococcus ...
CAA51554 155 GSYTLQTMLTSVITTGFIGLLFILNTMAIQHPFNACLGPNENQTRTLKLAASTG----FISMAIVGLLGIGLNPSwwLVS 230 Methanothermobacter...
O32865   165 GDFTWSAVYSKVIATGLIAVLWAICAISLLHPFNACLGPSETQERTLWLGAECG----SLCTVVAGLATANPVV-----L 235 Methanopyrus kandle...
O59638   230 LVGLVIWYVAFSKYYALIKRDAYAVVGTGLLPSAEE 265 Methanosarcina mazei Go1
CAB41640 230 LIGIIIWYVAFSKHYALIKRDAYAVVGSGMLPSSEE 265 Methanosarcina barkeri
Q58259   230 IVSIILWAIVYVKFVKMSFKDACAVLHVPEIPKKEE 265 Methanocaldococcus jannaschii DSM 2661
CAA51554 231 LIGALCWIVAFRAFVSASFEEAASVKWSGLWPKEEE 266 Methanothermobacter thermautotrophicus
O32865   236 LAGAAAWLITFWKFWELTKRDAADVVWTGIVPKGE- 270 Methanopyrus kandleri AV19
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap