Conserved Protein Domain Family
V_ATP_synt_G

?
TIGR01147: V_ATP_synt_G 
vacuolar ATP synthase, subunit G
This model describes the vacuolar ATP synthase G subunit in eukaryotes and includes members from diverse groups e.g., fungi, plants, parasites etc. V-ATPases are multi-subunit enzymes composed of two functional domains: A transmembrane Vo domain and a peripheral catalytic domain V1. The G subunit is one of the subunits of the catalytic domain. V-ATPases are responsible for the acidification of endosomes and lysosomes, which are part of the central vacuolar system. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130217
View PSSM: TIGR01147
Aligned: 5 rows
Threshold Bit Score: 103.756
Threshold Setting Gi: 2493140
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P78713   1 MSAQKSaGIQLLLDAEREATKIVQKAREYRTKRVREARDEAKKEIEAYKAQKEAEFKKFEAEHTQGNQAAQEEANAEAEA 80  Neurospora crassa OR74A
P91303   1 MASQTQ-GIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGTKEDIESKIRRDTED 79  Caenorhabditis elegans
Q25532   1 MASQTH-GIQQLLAAEKRAAEKVSEARKRKAKRLKQAKEEAQDEVEKYRQERERQFKEFEAKHMGTREGVAAKIDAETRI 79  tobacco hornworm
P79251   1 MASQSQ-GIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEVEQYRLQREKEFKAKEAAALGSHGSCSTEVEKDTQE 79  cattle
P48836   1 MSQKN--GIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQKNAGGVGELEKKAEAGVQG 78  Saccharomyces cerevis...
P78713  81 RIREIKEAGNKNREQVIKDLLHAVFTPSPEAMAA 114 Neurospora crassa OR74A
P91303  80 QISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHN 113 Caenorhabditis elegans
Q25532  80 KIDEMNKMVQTQKEAVIKDVLNLVYDIKPELHIN 113 tobacco hornworm
P79251  80 KMTILQTYFQQNRDEVLDNLLAFVCDIRPEIHEN 113 cattle
P48836  79 ELAEIKKIAEKKKDDVVKILIETVIKPSAEVHIN 112 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap