Conserved Protein Domain Family
ATP_synt_delta

?
TIGR01145: ATP_synt_delta 
ATP synthase, F1 delta subunit
This model describes the ATP synthase delta subunit in bacteria, mitochondria, and chloroplasts. It is sometimes called OSCP for Oligomycin Sensitivity Conferring Protein. F1/F0-ATP synthase is a multisubunit, membrane associated enzyme found in bacteria and organelles of higher eukaryotes, namely, mitochondria and chloroplast. This enzyme is principally involved in the synthesis of ATP from ADP and inorganic phosphate by coupling the energy derived from the proton electrochemical gradient across the biological membrane. A brief description of this multisubunit enzyme complex: F1 and F0 represent two major clusters of subunits. Delta subunit belongs to the F1 cluster or sector and functionally implicated in the overall stability of the complex. Expression of truncated forms of this subunit results in low ATPase activity. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130215
View PSSM: TIGR01145
Aligned: 10 rows
Threshold Bit Score: 178.661
Threshold Setting Gi: 231601
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P37811   6 VSKRYASALFDIANESAQLNQVEEELIVVKQVFQNEKALNDVLNHPKVPAAKKKELIQNAFG-SLSQSVlNTIFLLIDRH 84  Bacillus subtilis sub...
P12406  10 VAQPYAQALLSIAKSKSLTEEFGTDARTLLNLLTENQQLRNFIDNPFIAAENKKALIKQILSeASPYLR-NFLLLLVDKR 88  Nostoc sp. PCC 7120
Q40610   6 IADAYAEALLELANSNKSLKETTNDMNIVSQFLANSSDLKKFLGNPLITRERKKNVLKDVLGeQISSVSlNFLMLLVNRG 85  Ochrosphaera neapolitana
P35010   7 IAKVYAEGLFEIANTKNSLAEINEQLNSIKSVLKQMPEFYYFLVNPLISQQIKKNTIKIVFNnNLDKITlNFLLILIERR 86  Galdieria sulphuraria
P00831   7 VARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKN-EQMAELLSG-ALAPETLAESFIAVCGeQLDENGqNLIRVMAENG 84  Escherichia coli
P12987   7 IARPYAKAAFDFALEKDQLDQWGQMLSFAAEVAKN-EQMNELLTG-SVSADKMAEIFVAVCGeQVDTHGqNLLKVMAENG 84  Vibrio alginolyticus
P43717   7 IARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAED-ETVKAYLSS-SLSAQKLADTVISICGeQLDQYGqNLIRLMAENK 84  Haemophilus influenza...
O51875   7 IARPYAKAIFELAIENQSIEKWKKTLIFINEIIRS-KKIEKFLSG-SLSPSYLSSFFIFVAGdHIDKDArNLIKLLAENQ 84  Buchnera aphidicola s...
P29708   6 VGRRYAEAIYEIAESNDNVKELYETLNGVMELYNTDKEFKTLVDHPLIKREDKKEFAKKIFG-ELEESSlNIIFYLIEKD 84  Propionigenium modestum
S17723   6 VANRYRYALFQLAEEKSILSQVVQEMELVKEVVNTTPEFLQLLSHPKVTTEKKRAFIENSFKdSLSETSlHTLLLLVENK 85  Bacillus firmus
P37811  85 RAAIVPELTDEFIKLANVARQTEDAIVYSVKPLTDAEMLPLSQVFAKKAGVASLRIRNEVQTDLIGGIKVRIGNRIYDGS 164 Bacillus subtilis sub...
P12406  89 RIFFLPEILQQYLALLRQLNQTVLAEVTSAVALTEDQQQAVTEKVLALTKARQVELATKVDSDLIGGVIIKVGSQVIDSS 168 Nostoc sp. PCC 7120
Q40610  86 RVAFLDKIAQKFLELSYKQDAIEIAKVTSSVALSAQQQKELAGKLKLITGAKKIKLALRVEPKLIGGFTVEIGSKLIDTS 165 Ochrosphaera neapolitana
P35010  87 RIIYFYDIVDQFILIWNKATNTSVVEIASVISLTEKQQQYLINKLKEITKANYIKLKLKIDPSLIGGLIIKFGSNLIDLS 166 Galdieria sulphuraria
P00831  85 RLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSR-KVKLNCKIDKSVMAGVIIRAGDMVIDGS 163 Escherichia coli
P12987  85 RLAALPDVCTEFYTLKKEHEKEIDVEVISATELSDEQLANIGSKLEKRLER-KVKLNCSVDETLLGGVIIRAGDLVIDDS 163 Vibrio alginolyticus
P43717  85 RLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNATQIEKIAAAMEKRLAR-KVKLNCNVDNALIAGVIVRTEDFVIDGS 163 Haemophilus influenza...
O51875  85 RFKIFNNILRQFLKLETSYQGNTIIELISAYSLQEHEIIDIRCILQKIFLS-KIKFIYKIDHQILDGIIIKKADTVFDFS 163 Buchnera aphidicola s...
P29708  85 RLSSIRGIVAEYLKIYYAKNQILDVEAIFAIEPTKDQKAKLIEQLEKKTGK-KVNLEVSIDKSIIAGGIIKIGDEIIDGS 163 Propionigenium modestum
S17723  86 RIESLVDMIDSFKEMSYEAQDMAEAVVYSAKPLTSEEQAQIAVIFAKKVNKAKLLVINVVNKDLLGGLKIRIGDRIYDGR 165 Bacillus firmus
P37811 165 VSGKLQRIERQL 176 Bacillus subtilis subsp. subtilis str. 168
P12406 169 IRGQLRRLSLRL 180 Nostoc sp. PCC 7120
Q40610 166 IRGQLKKISNLL 177 Ochrosphaera neapolitana
P35010 167 LKGKLKNSPYI- 177 Galdieria sulphuraria
P00831 164 VRGRLERLADVL 175 Escherichia coli
P12987 164 ARGRLNRLSDAL 175 Vibrio alginolyticus
P43717 164 SRGQLTRLANEL 175 Haemophilus influenzae Rd KW20
O51875 164 VRSYLKQLSDVL 175 Buchnera aphidicola str. Sg (Schizaphis graminum)
P29708 164 VRRQLDTIARS- 174 Propionigenium modestum
S17723 166 VKSQLDRLERQL 177 Bacillus firmus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap