Conserved Protein Domain Family
ATP_synt_b

?
TIGR01144: ATP_synt_b 
ATP synthase, F0 subunit b
This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130214
View PSSM: TIGR01144
Aligned: 8 rows
Threshold Bit Score: 124.823
Threshold Setting Gi: 584815
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P00859    10 QAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQILDE 89  Escherichia coli
P12989    10 QAISFALFVWFCMKYVWPPLMKAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKRTATEIIEQANKRKSQILDE 89  Vibrio alginolyticus
P43720    10 QLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKLQAQDILDAANKRRNEVLDE 89  Haemophilus influen...
O51876    10 QALSFILFVWFCMKYIWPPIIFAIETRQKNIEESLISLKKAEEELIIIQKKMNQIIQDSKEKASFIINEANKKKSIILED 89  Buchnera aphidicola...
P41172    13 QLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRATELVREAKDKAAEIIANAERRGVELREE 92  Acidithiobacillus f...
CAA46896  13 QIINFLILMFFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVKSAKTEANEMLLRAEKKADERKET 92  Propionigenium mode...
AAD13379  16 VTGSFILLLLLVKKFAWSQLAAIFKTREEKIAKDIDDAENSRQNAQVLENKRQVELNQAKDEAAQIIDNAKETGKAQESK 95  Streptococcus mutan...
P37814    20 QLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEKNKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEE 99  Bacillus subtilis s...
P00859    90 AKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156 Escherichia coli
P12989    90 AREEAQAERQKILAQAEAELEAERNRARDDLRKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156 Vibrio alginolyticus
P43720    90 VKAEAEELKAKIIAQGYAEVEAERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156 Haemophilus influenzae Rd KW20
O51876    90 AKSIALEESKKIFLRNQLEIDLKVMQVRKNLHKEIVDLSILIAEKIIKDNIQKDQYKYSIKKLIVSL 156 Buchnera aphidicola str. Sg (Sch...
P41172    93 AQGKAREEADRIIASARAEIDVETNRAREVLRGQVVELVVNGTQRILHREIDDQTHRDIIDRMVGQL 159 Acidithiobacillus ferrooxidans
CAA46896  93 ILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVTDLAVKLAEKMINEKVDAKIGANLLDQFIGEV 159 Propionigenium modestum
AAD13379  96 IITEAHEEAGRLKDKANQDIATSKAEALSSVKADVADLSVLLAEKIMAKNLDKTAQGDLIDSYLDKL 162 Streptococcus mutans GS-5
P37814   100 IIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEV 166 Bacillus subtilis subsp. subtili...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap