1EYZ,2CZG


Conserved Protein Domain Family
purT

?
TIGR01142: purT 
Click on image for an interactive view with Cn3D
phosphoribosylglycinamide formyltransferase 2
This enzyme is an alternative to PurN (TIGR00639) [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 130212
View PSSM: TIGR01142
Aligned: 10 rows
Threshold Bit Score: 547.8
Threshold Setting Gi: 503754665
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EYZ_A        14 RVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQ 93  Escherichia coli
Q58881        13 KFLLLGSGELGKEVVIEAQRLGIECIAVDRYQNAPAMQVAHKSYVIDMKDYDALMAIIEREEPDYIVPEIEAINTDALID 92  Methanocaldococ...
Q55336        10 TFLLLGSGELGKEFTIAAQRLGNRVIAVDRYPDAPAMQVAQVAEVISMLDGNALEAVVKKYQPDWIVPEVEAIRTEKLLE 89  Synechocystis s...
WP_001881005  14 RVLLLGSGELGKEVAIECQRLGLEVIACDRYADAPAMQVAHRSHVFDMLDADALQQVIDLEKPHFVVPEIEAIATSKLVE 93  Vibrio cholerae
P39771         6 KVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVAHNSYVVDMLDPEQIRTIIEKENPDLIVPEVEAIATDELLK 85  Bacillus subtil...
WP_003092658  14 RVLLCGSGELGKEVAIELQRLGCEVIAVDRYGNAPAMQVAHRSHVISMLDGAALRAVIEQEKPHYIVPEIEAIATATLVE 93  Pseudomonas
O58056        18 KILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFE 97  Pyrococcus hori...
WP_010868759  18 KILLLGSGELGKEIAIEAQRLGVEVIAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFE 97  Pyrococcus abyssi
WP_013988741  27 RVMLLGSAEPSRELAIALQGLGAEVIAVDGYVGAPAHRIADQSVVVTMTDAEELTAVIRRLQPDFLVTVTAAVSVDALDA 106 Mycobacterium a...
2CZG_A        21 KILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFE 100 Pyrococcus hori...
1EYZ_A        94 LEEEG---LNVVPCARATKLTMNREGIRRLAAEELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRS 170 Escherichia coli
Q58881        93 AEKMG---YTVIPTAEATKITMNRELIRRLAAEKLGLKTAKYEFADSLEELRDAVEKLGLPCVVKPIMSSSGKGQSVVRS 169 Methanocaldococ...
Q55336        90 LEAGG---YRVIPTAQATNLTMNRDRIRELAAQQLGVRTARYNYATSLAELEEVSQAIGFPNVVKPVMSSSGKGQSVVNN 166 Synechocystis s...
WP_001881005  94 LEAQG---LNVVPTANATRLTMNREGIRRLAAEELGLPTSAYQFADSYESFAAAVETIGLPCVCKPVMSSSGKGQSVIRT 170 Vibrio cholerae
P39771        86 LEEEG---FHVIPNARAAKLTMDREGIRRLAAETLGLATAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRS 162 Bacillus subtil...
WP_003092658  94 LEAEG---YTVVPTARAAQLTMNREGIRRLAAEELGLPTSPYHFADTFEDYRRGVERVGYPCVVKPIMSSSGKGQSVLKG 170 Pseudomonas
O58056        98 FEKDG---YFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHTKAIMSSSGKGSYFVKG 174 Pyrococcus hori...
WP_010868759  98 FEKEG---YFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHTKAIMSSSGKGSYFVKG 174 Pyrococcus abyssi
WP_013988741 107 VEQADgecTELVPNARAVRCTADREGLRRLAADQLGLPTAPFWFVGSLGELQAVAVHAGFPLLVSPVAGVAGQGSSVVAG 186 Mycobacterium a...
2CZG_A       101 FEKDG---YFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHTKAIMSSSGKGSYFVKG 177 Pyrococcus hori...
1EYZ_A       171 AEQLAQAWKYA-----QQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDG-----VHFCAPVGHRQEDGDYRESWQPQQMS 240 Escherichia coli
Q58881       170 EEDIEKAWKIA-----KEGARGIGNRVIVEEFINFDYEITLLTARTAEG-----TKFCEPIGHVQIDGDYHESWQPHNMS 239 Methanocaldococ...
Q55336       167 AGEVQQAWSAA-----IAGARGDQTKVIVEEFIPFELEITLLTIRQWQGe----TLFCDPIGHRQERGDYQESWQPAPLT 237 Synechocystis s...
WP_001881005 171 PEQIEAAWQYA-----QQGGRSGAGRVIVEGFVDFDYEITLLTVRAVDG-----VHFCAPIGHRQEDGDYRESWQPQVMS 240 Vibrio cholerae
P39771       163 EADLESCWETA-----MEGGRVKNGRVIVEEFIPFESEITLLTVRAVNG-----TAFCEPIGHVQKDGDYIESWQPHDMT 232 Bacillus subtil...
WP_003092658 171 PDDLQAAWDYA-----QEGGRAGKGRVIVEGFIDFDYEITLLTVRHVDG-----TTFCAPIGHRQVKGDYHESWQPQAMS 240 Pseudomonas
O58056       175 PEDIPKAWEEA-----KTKARGSAEKIIVEEHIDFDVEVTELAVRHFDEngeivTTFPKPVGHYQIDGDYHASWQPAEIS 249 Pyrococcus hori...
WP_010868759 175 PEDIPKAWEEA-----KTKARGSAEKIIVEEHIDFDVEITELAVRHFDEngeivTTFPKPVGHYQIDGDYHASWQPAEIS 249 Pyrococcus abyssi
WP_013988741 187 PNEVEPAWQRAaghqvQPQTGGVSPRVCAESVVEIEFLVTMIVVCSQGPng-plIEFCAPIGHRDADAGELESWQPQKLS 265 Mycobacterium a...
2CZG_A       178 PEDIPKAWEEA-----KTKARGSAEKIIVEEHIDFDVEVTELAVRHFDEngeivTTFPKPVGHYQIDGDYHASWQPAEIS 252 Pyrococcus hori...
1EYZ_A       241 PLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQ--DLSEFALHVRAFLGLPVGg---- 314 Escherichia coli
Q58881       240 AELKEQAQDIAKKVTDALGGYGIFGVELFVKGDEVIFSEVSPRPHDTGMVTMITQ--EMSEFEIHVRAILGLPVS----- 312 Methanocaldococ...
Q55336       238 QRQLAQAQAIAKTVTDALGGAGIFGVEFFITPEEVIFSELSPRPHDTGMVTLISQ--NLNEFELHLRAILGLPIPq---- 311 Synechocystis s...
WP_001881005 241 ENAIKAAEYVAEQVVNALGGYGLFGVELFVKGDKVIFNEVSPRPHDTGMVTLISQ--ELSEFALHVRAFTGLPIGq---- 314 Vibrio cholerae
P39771       233 EQQIEEAKHIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGLVTLVTQ--NLSEFALHVRAILGFPITe---- 306 Bacillus subtil...
WP_003092658 241 AQALAESERVARAVTEALGGRGLFGVELFVKGDQVWFSEVSPRPHDTGLVTLISQ--DLSEFALHARAILGLPIPv---- 314 Pseudomonas
O58056       250 EKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHppGFSEFALHLRAVLGLPIPgewvd 329 Pyrococcus hori...
WP_010868759 250 EKAEREVYRIAKRITDVLGGLGLFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHppGFSEFGLHLRAVLGLPIPgewvd 329 Pyrococcus abyssi
WP_013988741 266 TAALDAAKSIAARIVKALGGRGVFGVELMINGDEVYFADVTVCPAGSAWVTVRSQ--RLSVFELQARAILGLAVD----- 338 Mycobacterium a...
2CZG_A       253 EKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHppGFSEFALHLRAVLGLPIPgewvd 332 Pyrococcus hori...
1EYZ_A       315 ----IRQYGPAASAVILPqlTSQNVTFD------N-VQNAVG-ADLQIRLFGKPEIDGSRRLGVALATAESVVDAIERAK 382 Escherichia coli
Q58881       313 ----TKLIHPGASHVIKA--EINKYAPK------YhIEDALKvPNTKLRLFGKPNAKVGRRMGVALAYADSVEKARELAE 380 Methanocaldococ...
Q55336       312 ----IKQTGPAASAVILAleAGEKLSYA------G-LAEALTeSGTDVRLFGKPNARPHRRLGVALAQAESVDAARRLAQ 380 Synechocystis s...
WP_001881005 315 ----IVQYGPSASAAILGqgQSQNIQFN------G-LDDALSiPHTQVRLFGKPDIAGRRRLGVALSRGKTTQEATDRAI 383 Vibrio cholerae
P39771       307 ----ITQLSPGASRPLKApeELADYTVE------G-LENALAvPKTQVRVFGKPITKAGRRMAVALSAADSVETARENAK 375 Bacillus subtil...
WP_003092658 315 ----IRQLGPSASAVILVegKSRQVAFA------N-LGAALSeADTALRLFGKPEVDGQRRMGVALARDESIDAARAKAT 383 Pseudomonas
O58056       330 gyrlFPMLIPAATHVIKAkvSGYSPRFR------G-LVKALSvPNATVRLFGKPEAYVGRRLGIALAWDKDVEVAKRKAE 402 Pyrococcus hori...
WP_010868759 330 gyrlFPMLIPAATHVIKAkvKGYSPRFR------G-LAKALSvPNATVRLFGKPEAYVGRRLGVVLAWDKDVQEAKKRAE 402 Pyrococcus abyssi
WP_013988741 339 ----TLMISPGAARVINPdhTAGRAAVGaappadA-LTGALGvPESDVVIFG-------RGLGVALATAPEVAIARERAR 406 Mycobacterium a...
2CZG_A       333 gyrlFPMLIPAATHVIKAkvSGYSPRFR------G-LVKALSvPNATVRLFGKPEAYVGRRLGIALAWDKDVEVAKRKAE 405 Pyrococcus hori...
1EYZ_A       383 HAAGQVKVQ 391 Escherichia coli
Q58881       381 KCAHAVRIE 389 Methanocaldococcus jannaschii DSM 2661
Q55336       381 TVAEKVIVQ 389 Synechocystis sp. PCC 6803 substr. Kazusa
WP_001881005 384 ECAKAVKIH 392 Vibrio cholerae
P39771       376 KALDQLILK 384 Bacillus subtilis subsp. subtilis str. 168
WP_003092658 384 RAAQAVRVE 392 Pseudomonas
O58056       403 MVAHMIELR 411 Pyrococcus horikoshii OT3
WP_010868759 403 MVAHMIELR 411 Pyrococcus abyssi
WP_013988741 407 EVASRLNVP 415 Mycobacterium africanum
2CZG_A       406 MVAHMIELR 414 Pyrococcus horikoshii OT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap