2BHS


Conserved Protein Domain Family
cysM

?
TIGR01138: cysM 
Click on image for an interactive view with Cn3D
cysteine synthase B
CysM differs from CysK in that it can also use thiosulfate instead of sulfide, to produce cysteine thiosulfonate instead of cysteine. Alternate name: O-acetylserine (thiol)-lyase [Amino acid biosynthesis, Serine family]
Statistics
?
PSSM-Id: 130208
View PSSM: TIGR01138
Aligned: 4 rows
Threshold Bit Score: 503.292
Threshold Setting Gi: 6225233
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BHS_A     3 TLEQTIGNTPLVKLQRMGPD---NGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGDVLIEATSGNTGIALAMI 79  Escherichia coli K-12
AAG04321   7 TIADCVGNTPLVRLQRLPGE---TSNTLLVKLEGNNPAGSVKDRPALSMITRAELRGDIRPGDTLIEATSGNTGIALAMA 83  Pseudomonas aerugin...
P16703     3 TLEQTIGNTPLVKLQRMGPD---NGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGDVLIEATSGNTGIALAMI 79  Escherichia coli K-12
O67507    24 TILKLVGNTPLVRVKKCLPEdipEDVEIWAKLESFNPGGSVKDRPALSMFLDALKRGLIKEGKVVIDATSGNTGIALAMV 103 Aquifex aeolicus VF5
2BHS_A    80 AALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGARDLALEMANRGEGK--LLDQFNNPDNPYAHYTTTGPE 157 Escherichia coli K-12
AAG04321  84 AAIKGYKMILIMPDNSTAERKAAMTAYGAELILVSKEEGMEGARDLADKLQREGRGK--VLDQFANGDNPEAHYHSTGPE 161 Pseudomonas aerugin...
P16703    80 AALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGARDLALEMANRGEGK--LLDQFNNPDNPYAHYTTTGPE 157 Escherichia coli K-12
O67507   104 GAALGVPVELAMPANVSEERKKIIKAFGAKLYLTDPLEGTDGAILFVRELVQKYPEKyvYLDQYNNPANWKAHFYSTGIE 183 Aquifex aeolicus VF5
2BHS_A   158 IWQQTGGRITHFVSSMGTTGTITGVSRFMREQSKPVTIVGLQPEEGSS-IPGIRRWPTEYLPGIFNASLVDEVLDIHQRD 236 Escherichia coli K-12
AAG04321 162 IWQQTGGSITHFVSSMGTTGTIMGVSRYLKEQNPAVQIVGLQPMEGSA-IPGIRRWPQEYLPKIYDASRVDRVVDMHQDE 240 Pseudomonas aerugin...
P16703   158 IWQQTGGRITHFVSSMGTTGTITGVSRFMREQSKPVTIVGLQPEEGSS-IPGIRRWPTEYLPGIFNASLVDEVLDIHQRD 236 Escherichia coli K-12
O67507   184 IWNQTKGRITHFVAGIGTGGTIMGTGRRLKIYNPNIQVIGVQPAYPFHgIEGLKHIESSIKPGIFDETFLDRTIFVETED 263 Aquifex aeolicus VF5
2BHS_A   237 AENTMRELAVREGIFCGVSSGGAVAGALRVAKANPD----AVVVAIICDRGDRYLSTGVF 292 Escherichia coli K-12
AAG04321 241 AEDIMRRLAREEGIFCGVSSGGAVAAMLRLSRELEN----AVLVAIICDRGDRYLSSGVY 296 Pseudomonas aeruginosa PAO1
P16703   237 AENTMRELAVREGIFCGVSSGGAVAGALRVAKANPD----AVVVAIICDRGDRYLSTGVF 292 Escherichia coli K-12
O67507   264 AYYWARELAKKDAIFVGQSSGAALWACIQLARELAKkgekGVIVTVFPDGGEKYLTTALF 323 Aquifex aeolicus VF5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap