1TDJ


Conserved Protein Domain Family
ilvA_2Cterm

?
TIGR01124: ilvA_2Cterm 
Click on image for an interactive view with Cn3D
threonine ammonia-lyase, biosynthetic, long form
This model describes a form of threonine ammonia-lyase, a pyridoxal-phosphate dependent enzyme, with two copies of the threonine dehydratase C-terminal domain (pfam00585). Members with known function participate in isoleucine biosynthesis and are inhibited by isoleucine. Alternate name: threonine deaminase, threonine dehydratase. Forms scoring between the trusted and noise cutoff tend to branch with this subgroup of threonine ammonia-lyase phylogenetically but have only a single copy of the C-terminal domain. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 130194
View PSSM: TIGR01124
Aligned: 7 rows
Threshold Bit Score: 899.869
Threshold Setting Gi: 157833920
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TDJ_A        15 EYLRAVLR--APVYEAAQVTPLQKMEKLSSRLDNVILVKREDRQPVHSFKLRGAYAMMAGLTEEQKAHGVITASAGNHAQ 92  Escherichia coli
P46493        14 DYINAIVKlgSRVYEAAQVTPLQKMGKLSERLHNNIWIKREDRQPVNSFKLRGAYAMISSLSAEQKAAGVIAASAGNHAQ 93  Haemophilus inf...
AAF10147      69 DVLRLALT--SQVYGAATETPLSPAPRLSERSGNRVLLKREDQQPIFSFKLRGAYNKMSQLSAEERARGVICASAGNHAQ 146 Deinococcus rad...
WP_002225371   9 DYLIRILT--ASVYDVAVETPLEPARSLSVRLKNNILLKREDLQPVFSFKIRGAYNKMSKLPKDALACGVIAASAGNHAQ 86  Neisseria menin...
WP_010872036   4 DYLERILK--ARVYDVAIETPLDLAANLSKRLGNRVYFKREDLQPVFSFKLRGAYNKMAQLSPELLAKGVIAASAGNHAQ 81  Synechocystis s...
WP_011715185  17 QLFRHILT--SRVYEAAVETPLEQSAWLSAQLRNQVFIKREDLQPVFSFKLRGAYNKMAQLTPEQRARGIIAASAGNHAQ 94  Magnetococcus m...
P04968        15 EYLRAVLR--APVYEAAQVTPLQKMEKLSSRLDNVILVKREDRQPVHSFKLRGAYAMMAGLTEEQKAHGVITASAGNHAQ 92  Escherichia col...
1TDJ_A        93 GVAFSSARLGVKALIVMPTATADIKVDAVRGFGGEVLLHGANFDEAKAKAIELSQQQGFTWVPPFDHPMVIAGQGTLALE 172 Escherichia coli
P46493        94 GVALSAKQLGLKALIVMPQNTPSIKVDAVRGFGGEVLLHGANFDEAKAKAIELSKEKNMTFIPPFDHPLVIAGQGTLAME 173 Haemophilus inf...
AAF10147     147 GVAFAGEKLGIPAVIVMPATTPDIKVQACRARGAEVILHGDSFSDAETFALALQQERGLTFVHPYDDPLVLAGQGTIALE 226 Deinococcus rad...
WP_002225371  87 GVALSAQRLGCRAVIVMPETTPKIKVDAVKSHGGEVVLRGVSYNDAYDYAMELAEKEGLTYIAPFDDPDVIAGQGTVGME 166 Neisseria menin...
WP_010872036  82 GVALGASKLGTRAIIVMPETTPQVKVEAVKARGGVVVLYGETYDDAYGHARQLEQEKGLTFIHPFNDPDVIAGQGTIGME 161 Synechocystis s...
WP_011715185  95 GVAFSARQLGLSATIVMPCTTPEIKVGAVKQFGAQVVLHGDNYSIAADHCKELAQHNGMTFIHPFDDELVIAGQGTVGLE 174 Magnetococcus m...
P04968        93 GVAFSSARLGVKALIVMPTATADIKVDAVRGFGGEVLLHGANFDEAKAKAIELSQQQGFTWVPPFDHPMVIAGQGTLALE 172 Escherichia col...
1TDJ_A       173 LLQQDA-HLDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFAEGVAVKRIGDET 251 Escherichia coli
P46493       174 MLQQVA-DLDYVFVQVGGGGLAAGVAILLKQFMPEIKIIGVESKDSACLKAALDKGEPTDLTHIGLFADGVAVKRIGDET 252 Haemophilus inf...
AAF10147     227 LLRQVEeDDYAVFVPVGGGGLIAGVASILKALKPGVRVIGVEPDDSDAMYQSLQAGERVRLDTVGIFVDGVAVKQVGAYT 306 Deinococcus rad...
WP_002225371 167 IVSQHPdPIRAVFVPIGGGGLAAGVAAFIKQVRPEIKVIGVQTNDSCCMKQSVEAGEIVHLKDVGLFSDGTAVKVVGNET 246 Neisseria menin...
WP_010872036 162 ILRQYQqPIDAIFVAIGGGGLIAGVAAYVKRLYPEIKIIGVEPTDADAMRQSLAAGKRVKLNQVGLFADGVAVREVGDLT 241 Synechocystis s...
WP_011715185 175 IMRQSGnQLDAIFVPVGGGGLIAGIATYVKNLLPQIRIIGVEPTDSDAMARALEAGKIVSLDQVGIFADGVAVREVGTRT 254 Magnetococcus m...
P04968       173 LLQQDA-HLDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFAEGVAVKRIGDET 251 Escherichia col...
1TDJ_A       252 FRLCQEYLDDIITVDSDAICAAMKDLFEDVRAVAEPSGALALAGMKKYIALHNIRGERLAHILSGANVNFHGLRYVSERC 331 Escherichia coli
P46493       253 FRLCQQYLDDMVLVDSDEVCAAMKDLFENVRAVAEPSGALGLAGLKKYVKQNHIEGKNMAAILSGANLNFHTLRYVSERC 332 Haemophilus inf...
AAF10147     307 FDLTRRYVDDWVRVNTDEVCAAIKDVFDDTRAVLEPAGALSVAGLKKYAATHGLHDRTLVALTCGANINFDRLRHVAERT 386 Deinococcus rad...
WP_002225371 247 FRLCKELLDEIITVDTDAVCGAVKDIFDDTRSITEPAGALALAGLKAYIAREGAENQTLIAVTSGANMNFHRLRHVSERS 326 Neisseria menin...
WP_010872036 242 FPLCQQYVDDILLVDTDDTCAAIKDCFEDTRSILEPAGALAIAGLKQYVQKQGCRDQTLVAIACGANMNFDRLRFVAERA 321 Synechocystis s...
WP_011715185 255 LALCEQYVDEMVRVNVDEICTAIKWTYQATRAIVEPAGALALAGLRRYVAEKGITGQRLVVINSGANMNFERLRYVTERT 334 Magnetococcus m...
P04968       252 FRLCQEYLDDIITVDSDAICAAMKDLFEDVRAVAEPSGALALAGMKKYIALHNIRGERLAHILSGANVNFHGLRYVSERC 331 Escherichia col...
1TDJ_A       332 ELGEQREALLAVTIPEEKGSFLKFC-QLLGGRSVTEFNYRFADAKNACIFVGVRLSRGlEERKEILQMLNDGGYSVVDLS 410 Escherichia coli
P46493       333 EIGENREALLAVTMPEQPGSFLKFA-YVLGNRAVTEFSYRYADDKRACVFVGVRTTNE-QEKADIIADLTKNGFDVEDMS 410 Haemophilus inf...
AAF10147     387 EIGEQREAILAVTIPERPGAFLEFI-ELIGSRAITEFNYRYAPREDARIFVGVQLGQP-GERQELLTLLRGRGYAVLDLT 464 Deinococcus rad...
WP_002225371 327 ELGEGNEGIFAVTIPEERGSFLKFV-NILGNRNITEFNYRYGDDEKAHIFVGLQAAGP-QDLAVIGSRLDEAGLPNVDLT 404 Neisseria menin...
WP_010872036 322 EYGEQREAIFAVTIPEQRGSLRKFC-EGLGKHNITEFSYRIAEGPDAHIFVGIQVQNR-SDASQLAASFNRQGFKTLDLT 399 Synechocystis s...
WP_011715185 335 MVGEQREALFAITIPEQPGALRHFCqEVVGDHNITEFNYRLSGRDAAHIFVGIDLREP-AERQLLAHRLQSFHYQFVDLT 413 Magnetococcus m...
P04968       332 ELGEQREALLAVTIPEEKGSFLKFC-QLLGGRSVTEFNYRFADAKNACIFVGVRLSRGlEERKEILQMLNDGGYSVVDLS 410 Escherichia col...
1TDJ_A       411 DDEMAKLHVRYMVGGRPSHp---LQER--LYSFEFPESPGALLRFLNTLGTYWNISLFHYRSHGTDYGRVLAAFELGDHE 485 Escherichia coli
P46493       411 DDDIAKTHVRYLMGGRAAN----DNER--LYTFEFPEQKGALLKFLETLQNRWNISLFHYRAHGADYGNILAGFQIEQRE 484 Haemophilus inf...
AAF10147     465 EDELAKVHVRHMVGGRAPEa---VNER--VYAFTFPERPGALHDFLTQLQGEWNISLFHYRNHGSAHGRVLAGVQVPDAA 539 Deinococcus rad...
WP_002225371 405 NNEIAKIHIRYMVGGRTDKv---ENER--LVSFEFPERPGALARFLNHMQGGWNITLFHYRNHGADYGRILVGIDVPPHD 479 Neisseria menin...
WP_010872036 400 DDELTKLHLRHMVGGRPPQvtqlENQRelLYRFEFPERPGALMKFLGCMDPAWNISLFHYRNHGADYGRIVVGMQVPLAE 479 Synechocystis s...
WP_011715185 414 ENDLAKTHLRHMVGGRSHVv---QHER--LLRFRFPERPGALAHFLTTMQADWNISLFQYRLHGGEYGRVLIGLEVPPEQ 488 Magnetococcus m...
P04968       411 DDEMAKLHVRYMVGGRPSHp---LQER--LYSFEFPESPGALLRFLNTLGTYWNISLFHYRSHGTDYGRVLAAFELGDHE 485 Escherichia col...
1TDJ_A       486 PD-FETRLNELGYDCHDETNNPAFRFFL 512 Escherichia coli
P46493       485 QAeFEQGLAQLNYVFEDVTKSKSYRYFL 512 Haemophilus influenzae Rd KW20
AAF10147     540 LTrFGDFLAGLGYPAHDVTSNPAYRLFL 567 Deinococcus radiodurans R1
WP_002225371 480 AAaFDGFLESLGYSYHEETQNAAYKLFL 507 Neisseria meningitidis
WP_010872036 480 MEqWQQFLANLGYRYWDESDNPVYRLFL 507 Synechocystis sp. PCC 6803
WP_011715185 489 HDqLQSCLDKLGFRYVDESENPAYKLFL 516 Magnetococcus marinus
P04968       486 PD-FETRLNELGYDCHDETNNPAFRFFL 512 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap