1I1K


Conserved Protein Domain Family
ilvE_I

?
TIGR01122: ilvE_I 
Click on image for an interactive view with Cn3D
branched-chain amino acid aminotransferase, group I
Among the class IV aminotransferases are two phylogenetically separable groups of branched-chain amino acid aminotransferase (IlvE). The last common ancestor of the two lineages appears also to have given rise to a family of D-amino acid aminotransferases (DAAT). This model represents the IlvE family more strongly similar to the DAAT family. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 130192
View PSSM: TIGR01122
Aligned: 11 rows
Threshold Bit Score: 443.339
Threshold Setting Gi: 499180893
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1I1K_A        10 WFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHK--GPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVI 87  Escherichia col...
AAA67573      10 WFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHK--GPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVI 87  Escherichia col...
KFE26166      10 WFNGEMIPWANATVHVLTHAMHYGTSVFEGVRCYNTPK--GPIIFRHREHAQRLLDSAKIYRFPIPYSIETIMEATRETL 87  Vibrio cholerae
WP_011713515   9 WMDGQFVDWRDAKIHVLTHTLHYGMGVFEGIRCYEADQ--GPAIFRLGEHVERLFKSALILGMEMPYSRDVISQVCQDVI 86  Magnetococcus m...
WP_003095783  11 WYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYDTPQ--GTAIFRLQAHTDRLFDSAHIMNMQIPYSRDEINEATRAAV 88  Pseudomonas
WP_010903564  13 WMDGEFVDWEDAQVHVLTHALHYGSGIFEGVRVYDTDN--GPAIFRWDDHLQRFYESAKPYDLDIEFTPDELTDATVELI 90  Halobacterium s...
WP_002851928   8 WMDGKLVDFKDATLHFLTHSLHYGNAVFEGTRAYKTDK--GLAIFRLEDHTKRLLESAKITLLNCPFSQKELENAQIELL 85  Campylobacter j...
WP_010881237  11 FFEGKIVPVEEAKISIMTNSFHYGTAIFEGIRAYWNEEeeQLYILFAKEHYERLLTNARCLFMELNYSAEELVEITKEIL 90  Aquifex aeolicus
WP_010870521   4 YLNGKFVDEKDAKVSVFDHGLLYGDGVFEGIRAYDG------VVFMLKEHIDRLYDSAKSLCIDIPLTKEEMIDVVLETL 77  Methanocaldococ...
WP_010878433   5 YMDGEFVPENEAKVSIFDHGFLYGDGVFEGIRAYNG------RVFRLKEHIDRLYDSAKAIDLEIPITKEEFMEIILETL 78  Archaeoglobus f...
O27481        10 WLNGEMVEWEEATVHVLSHVVHYGSSVFEGIRCYRNSK--GSAIFRLREHVKRLFDSAKIYRMDIPYTQEQICDAIVETV 87  Methanothermoba...
1I1K_A        88 RKNNLT-S-AYIRPLIFVGDVGMGVNPp-AGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGN 164 Escherichia col...
AAA67573      88 RKNNLT-S-AYIRPLIFVGDVGMGVNPp-AGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRARPNTIPTAAKAGGN 164 Escherichia col...
KFE26166      88 RVNKLD-N-AYIRPLAYVGNVGLGVCPp-VGTEMDLMIAAFPWGAYLGEEALENGVDAMVSSWHRAAPNTIPTAAKAGGN 164 Vibrio cholerae
WP_011713515  87 KLNGLK-S-GYIRPLMYYGAESMGINP--APLKTHGMVAAWAWGAYLGEEGMEKGIRIKTSSYTRHHPNVVMTRAKAVGN 162 Magnetococcus m...
WP_003095783  89 RENNLE-S-AYIRPMVFYGSEGMGLRA--SGLKVHVIIAAWSWGAYMGEEALQQGIKVRTSSFTRHHVNISMTRAKSNGA 164 Pseudomonas
WP_010903564  91 QRQDLG-S-CYIRPLAYYGYESLGVSP--GDCPTDVAIAAWPWGAYLGDDALENGVDVMVSTWRKHASSQIPTNAKTTGL 166 Halobacterium s...
WP_002851928  86 KANNFK-SnVYIRPLIFLGDGVMGLYH--IKAPVRVGIAAWEWGAYLGEEGLEKGIKVKISSFARNSVKSCMGKAKASAN 162 Campylobacter j...
WP_010881237  91 RKSEIReD-VYIRPIAY--FKDLKLTPklIDYTPEIAIYLYRFGRYLDT---SKGIRAKVSSWRRNDDNSIPSRWKVAGA 164 Aquifex aeolicus
WP_010870521  78 RVNNLRd--AYIRLVVTRGVGDLGLDPrkCG-KPTIFCIAIPMPPLLG----EDGIRAITVSVRRLPVDVLNPAVKSLN- 149 Methanocaldococ...
WP_010878433  79 RKNNLRd--AYIRPIVTRGIGDLGLDPrkCQ-NPSIIVITKPWGKLYGDL-YEKGLTAITVAVRRNSFDALPPNIKSLN- 153 Archaeoglobus f...
O27481        88 RENGLE-E-CYIRPVVFRGYGEMGVHP--VNCPVDVAVAAWEWGAYLGAEALEVGVDAGVSTWRRMAPNTMPNMAKAGGN 163 Methanothermoba...
1I1K_A       165 YLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLA-KELGIEVREQV-L 242 Escherichia col...
AAA67573     165 YLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLA-KELGIEVREQV-L 242 Escherichia col...
KFE26166     165 YLSSLLVGGEARRHGYAEGIALSVDGYLSEGAGENIFVVKNGVILTPPTTSSILPGITRDSIMTLA-RDMGYEVREAN-I 242 Vibrio cholerae
WP_011713515 163 YPNSILAKSEALRCGYDEALLLDTEGYVAEGSGENLFLVQGQTLKTPPL-DSALNGITRNTVMTIA-AEMGLKVVEQR-F 239 Magnetococcus m...
WP_003095783 165 YINSMLALQEAISGGADEAMMLDPEGYVAEGSGENIFIIKDGVIYTPEVT-ACLNGITRNTILTLA-AEHGFKLVEKR-I 241 Pseudomonas
WP_010903564 167 YVNSMLAGEEARRNGFTEAIVLNKEGNVAEGPGENIFLVRDGELFTPGLSESILDGITRDTVITLA-EERGYTVHDDVsI 245 Halobacterium s...
WP_002851928 163 YLNSQIAKFEAIEAGYEEALMLDEEGFIAEGTGECFFIVKDGVLITPP-NDFSLKSITQDTVLKIA-HDLGITVLRQR-I 239 Campylobacter j...
WP_010881237 165 YVNSALAKTEALMSGYDEAILLNSQGYVAEGSGENIFIIKNGKAITPSPNEHILEGITRNAVITLLkKELVVEVEERP-I 243 Aquifex aeolicus
WP_010870521 150 YLNSVLAKIQANYAGVDEAFLLDDKGFVVEGTGDNIFIVKNGVLKTPPVYQSILKGITRDVVIKLA-KEEGIEVVEEP-L 227 Methanocaldococ...
WP_010878433 154 YLNNILAKIEANAKGGDEAIFLDRNGYVSEGSGDNIFVVKNGAITTPPTIN-NLRGITREAVIEII-NRLGIPFKETN-I 230 Archaeoglobus f...
O27481       164 YLNSQLAKMEAVRHGYDEAIMLDYHGYISEGSGENIFLVSEGEIYTPPVSSSLLRGITRDSVIKIA-RTEGVTVHEEP-I 241 Methanothermoba...
1I1K_A       243 SRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTG-ETEDKWGWLDQV 307 Escherichia coli K-12
AAA67573     243 SRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTG-ETEDKWGWLDQV 307 Escherichia coli str. K-12 su...
KFE26166     243 SREALYLADEIFMTGTAAEVVPVRSVDKITVGAGKRGPITKVVQDAYFGLFKG-TTEDKWGWLDYV 307 Vibrio cholerae
WP_011713515 240 PRDEVLVSDEAFFTGTAAEVTPIRELDDRQIGPGHAGPVTKEVQKRFFDIVHG-RDPKHMGWLTPV 304 Magnetococcus marinus
WP_003095783 242 TRDEVYIADEAFFTGTAAEVTPIREVDGRKIGAGRRGPVTEKLQKAYFDLVSG-KTEAHAEWRTLV 306 Pseudomonas
WP_010903564 246 SRGELHTADELFFTGSAAEVTPIKQVDNVEIGSGTRGPVTEELQTAFFDLVEA-G--DREEWFHYV 308 Halobacterium salinarum
WP_002851928 240 SRDEVYTADEAFFTGTAAEITPINNIDARIIGNGLRGSVTKKLQDAYFDVVYG-RNEKYASMLTYI 304 Campylobacter jejuni
WP_010881237 244 ARSELYTADEVFLTGTAAEVTPVVEIDNRKIGNGEIGPITKQLQEFYFNAVRG-KIQRYKKWLTPV 308 Aquifex aeolicus
WP_010870521 228 TLHDLYTADELFITGTAAEIVPVFEIDGRVINNKQVGEITKKLKEKFKDIRTKwGIKVYDE----- 288 Methanocaldococcus jannaschii
WP_010878433 231 GLYDLYTADEVFVTGTAAEIAPIVVIDGRKIGDGKPGEITRKLMEEFSKLTESeGVPIYE------ 290 Archaeoglobus fulgidus
O27481       242 TREMLYIADEAFFTGTAAEITPIRSVDGIEIGAGRRGPVTKLLQDEFFRIIRA-ETEDSFGWLTYI 306 Methanothermobacter thermauto...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap