3LQS


Conserved Protein Domain Family
D_amino_aminoT

?
TIGR01121: D_amino_aminoT 
Click on image for an interactive view with Cn3D
D-amino acid aminotransferase
This enzyme is a homodimer. The pyridoxal phosphate attachment site is the Lys at position 146 of the seed alignment, in the motif Cys-Asp-Ile-Lys-Ser-Leu-Asn. Specificity is broad for various D-amino acids, and differs among members of the family; the family is designated equivalog, but with this caveat attached. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130191
View PSSM: TIGR01121
Aligned: 7 rows
Threshold Bit Score: 470.373
Threshold Setting Gi: 17433704
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LQS_A     2 YTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITIPYTKDKFHQLLHELVEKNE 81  Bacillus sp. YM-1
P54692     2 KVLFNGRLMERSECAVDIEDRGYQFGDGVYEVIRIYNGILFTLDEHIARLYKSAAEIGIDLSFSEAELKSQLKELVDINQ 81  Bacillus licheniformis
O07597     2 KVLVNGRLIGRSEASIDLEDRGYQFGDGIYEVIRVYKGVLFGLREHAERFFRSAAEIGISLPFSIEDLEWDLQKLVQENA 81  Bacillus subtilis s...
P54694     3 KVFINGEFIDQNEAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVTEHFERFIRSASEIQLDLGYTVEELIDVVRELLKVNN 82  Staphylococcus haem...
AAA22252   3 YTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITIPYTKDKFHQLLHELVEKNE 82  Bacillus sp.
P54693     3 YSLWNDQIVEEGSITISPEDRGYQFGDGIYEVIKVYNGHMFTAQEHIDRFYASAEKIRLVIPYTKDVLHKLLHDLIEKNN 82  Lysinibacillus spha...
O85046     2 KVLVNNHLVEREDATVDIEDRGYQFGDGVYEVVRLYNGKFFTYNEHIDRLYASAAKIDLVIPYSKEELRELLEKLVAENN 81  Listeria monocytoge...
3LQS_A    82 LNTGHIYFQVTRGTS-PRAHQFPENt-VKPVIIGYTKENPRPLENLEKGVKATFVEDIRWLRCDIKSLNLLGAVLAKQEA 159 Bacillus sp. YM-1
P54692    82 RRDGGLYLQVTRGKA-PRKHQYGAG--LTPQVTAYTFPIQKPEKEQQNGVSAITADDMRWLRCDIKSLNLLYNVMIKQKA 158 Bacillus licheniformis
O07597    82 VSEGAVYIQTTRGVA-PRKHQYEAG--LEPQTTAYTFTVKKPEQEQAYGVAAITDEDLRWLRCDIKSLNLLYNVMTKQRA 158 Bacillus subtilis s...
P54694    83 IQNGGIYIQATRGVA-PRNHSFPTPe-VKPVIMAFAKSYDRPYDDLENGINAATVEDIRWLRCDIKSLNLLGNVLAKEYA 160 Staphylococcus haem...
AAA22252  83 LNTGHIYFQVTRGTS-PRAHQFPENt-VKPVIIGYTKENPRPLENLEKGVKATFVEDIRWLRCDIKSLNLLGAVLAKQEA 160 Bacillus sp.
P54693    83 LNTGHVYFQITRGTT-SRNHIFPDAs-VPAVLTGNVKTGERSIENFEKGVKATLVEDVRWLRCDIKSLNLLGAVLAKQEA 160 Lysinibacillus spha...
O85046    82 INTGNVYLQVTRGVQnPRNHVIPDDfpLEGVLTAAAREVPRNERQFVEGGTAITEEDVRWLRCDIKSLNLLGNILAKNKA 161 Listeria monocytoge...
3LQS_A   160 HEKGCYEAILHRNNTVTEGSSSNVFGIKDGILYTHPANNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVT 239 Bacillus sp. YM-1
P54692   159 QEASAFEAILIRDGLVTEGTSSNVYVAKQNVIYTHPVTTLILNGITRMKVLQLCEENGLNYEEKAVTKDELLNADEVFIT 238 Bacillus licheniformis
O07597   159 YEAGAFEAILLRDGVVTEGTSSNVYAVINGTVRTHPANRLILNGITRMNILGLIEKNGIKLDETPVSEEELKQAEEIFIS 238 Bacillus subtilis s...
P54694   161 VKYNAGEAIQHRGETVTEGASSNVYAIKDGAIYTHPVNNYILNGITRKVIKWISEDEDIPFKEETFTVEFLKNADEVIVS 240 Staphylococcus haem...
AAA22252 161 HEKGCYEAILHRNNTVTEGSSSNVFGIKDGILYTHPANNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVT 240 Bacillus sp.
P54693   161 SEKGCYEAILHRGDIITECSSANVYGIKDGKLYTHPANNYILNGITRQVILKCAAEINLPVIEEPMTKGDLLTMDEIIVS 240 Lysinibacillus spha...
O85046   162 HQQNALEAILHRGEQVTECSASNVSIIKDGVLWTHAADNLILNGITRQVIIDVAKKNGIPVKEADFTLTDLREADEVFIS 241 Listeria monocytoge...
3LQS_A   240 STTSEITPVIEIDGKLIRDGKVGEWTRKLQKQFETKIP 277 Bacillus sp. YM-1
P54692   239 STTAEVIPVTSIDGQTIGSGAPGPLTKNVQTALQNSIL 276 Bacillus licheniformis
O07597   239 STTAEIIPVVTLDGQSIGSGKPGPVTKQLQAAFQESIQ 276 Bacillus subtilis subsp. subtilis str. 168
P54694   241 STSAEVTPVVKIDGEQVGDGKVGPVTRQLQEGFNKYIE 278 Staphylococcus haemolyticus
AAA22252 241 STTSEITPVIEIDGKLIRDGKVGEWTRKLQKQFETKIP 278 Bacillus sp.
P54693   241 SVSSEVTPVIDVDGQQIGAGVPGEWTRKLQKAFEAKLP 278 Lysinibacillus sphaericus
O85046   242 STTIEITPITHIDGVQVADGKRGPITAQLHQYFVEEIT 279 Listeria monocytogenes EGD-e
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap