Conserved Protein Domain Family

TIGR01121: D_amino_aminoT 
Click on image for an interactive view with Cn3D
D-amino acid aminotransferase
This enzyme is a homodimer. The pyridoxal phosphate attachment site is the Lys at position 146 of the seed alignment, in the motif Cys-Asp-Ile-Lys-Ser-Leu-Asn. Specificity is broad for various D-amino acids, and differs among members of the family; the family is designated equivalog, but with this caveat attached. [Energy metabolism, Amino acids and amines]
PSSM-Id: 130191
Aligned: 7 rows
Threshold Bit Score: 470.373
Threshold Setting Gi: 17433704
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O07597   239 STTAEIIPVVTLDGQSIGSGKPGPVTKQLQAAFQESIQ 276 Bacillus subtilis subsp. subtilis str. 168
P54694   241 STSAEVTPVVKIDGEQVGDGKVGPVTRQLQEGFNKYIE 278 Staphylococcus haemolyticus
P54693   241 SVSSEVTPVIDVDGQQIGAGVPGEWTRKLQKAFEAKLP 278 Lysinibacillus sphaericus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap