1NN4


Conserved Protein Domain Family
rpiB

?
TIGR01120: rpiB 
Click on image for an interactive view with Cn3D
ribose 5-phosphate isomerase B
Involved in the non-oxidative branch of the pentose phospate pathway. [Energy metabolism, Pentose phosphate pathway]
Statistics
?
PSSM-Id: 130190
View PSSM: TIGR01120
Aligned: 4 rows
Threshold Bit Score: 246.75
Threshold Setting Gi: 499183173
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NN4_A        16 KIAFGCDHVGFILKHEIVAHLVERGVEVIDKgtWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGI 95  Escherichia coli
WP_001039837   9 QVFIGSDHAGLHLAEFVKHFLEDKRFKIQAF--LPTTRVDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGI 86  Helicobacter py...
P37351         3 KIAFGCDHVGFILKHEIVAHLVERGVEVIDKgtWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGI 82  Escherichia col...
WP_010880713   2 KIAIGSDHAGFPLKEKIKEFLKGEGHKVIDVgtHAQESTHYPIYAKEVVRAIRSGKAERGILICGTGIGMSITANKFRGI 81  Aquifex aeolicus
1NN4_A        96 RAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIE 158 Escherichia coli
WP_001039837  87 RAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVAESILEAFFSTEFEQGRHVLRIQKLDESL 149 Helicobacter pylori
P37351        83 RAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIE 145 Escherichia coli K-12
WP_010880713  82 RAALCTNEYMARMSRLHNDANVLCLGERVLGVELALSIVKVWLETPFEGGRHLKRLeiiseie 144 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap