Conserved Protein Domain Family
lacB

?
TIGR01119: lacB 
galactose-6-phosphate isomerase, LacB subunit
This family contains four members from low GC gram-positive bacteria. Galactose-6-phosphate isomerase is involved in lactose catabolism by the tagatose-6-phosphate pathway. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130189
View PSSM: TIGR01119
Aligned: 3 rows
Threshold Bit Score: 352.732
Threshold Setting Gi: 125915
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P23495     1 MRIAIGCDHIVTDVKMAVSEFLKSKGYEVLDFGTYDHVRTHYPIYGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPG 80  Lactococcus lactis ...
P26592     1 MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVGINNAVNKVPG 80  Staphylococcus aure...
AAA26905   1 MKIAIGCDHIWTDVKMELSKHIKEEGYEVLDVGTYDFTRTHYPIFGKKVGEAVSSGEADLGVCMCGTGVGISNAANKVPG 80  Streptococcus mutans
P23495    81 VRSALVRDMTSALYAKEELNANVIGFGGMITGGLLMNDIIEAFIEAEYKPTEENKKLIAKIEHVETHNAHQADEEFFTEF 160 Lactococcus lactis ...
P26592    81 VRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAKIKHLETSNADQADPHFFDEF 160 Staphylococcus aure...
AAA26905  81 VRTALVRDMTSALYSKEELNANVVSFGGAIIGKLLLFDIVDAFIKAQYKPTEENKKLIAKIKHLEAHNDKQADPHFFDEF 160 Streptococcus mutans
P23495   161 LEKWDRGEYHD 171 Lactococcus lactis subsp. lactis
P26592   161 LEKWDRGEYHD 171 Staphylococcus aureus subsp. aureus MW2
AAA26905 161 LEKWNRGDYHD 171 Streptococcus mutans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap