Conserved Protein Domain Family
mmdA

?
TIGR01117: mmdA 
methylmalonyl-CoA decarboxylase alpha subunit
This model describes methymalonyl-CoA decarboxylase aplha subunit in archaea and bacteria. Metylmalonyl-CoA decarboxylase Na+ pump is a representative of a class of Na+ transport decarboxylases that couples the energy derived by decarboxylation of carboxylic acid substrates to drive the extrusion of Na+ ion across the membrane. [Energy metabolism, ATP-proton motive force interconversion, Energy metabolism, Fermentation, Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130187
View PSSM: TIGR01117
Aligned: 4 rows
Threshold Bit Score: 947.352
Threshold Setting Gi: 415593
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC36820       6 EKIELLHEKLAKVKAGGGEKRVEKQHAQGKMTARERLAKLFDDNSFVELDQFVKHRCVNFGQEKKELPGEGVVTGYGTID 85  Veillonella par...
CAA05137       1 KKIQDLQKKKEKIALGGGIKRIEKQHASGKMTARERLAYLFDEGTFVEMDAFVQHRCTNFGMDKQDLPSESVVTGYGMVD 80  Propionigenium ...
WP_010879706   4 ELVEELYGKKEKIRQMGGKERIERQHEQGKLTARERIELLLDPGSFVEINPFVEKRNTDFGLDKMDLPADGVVTGYGTVD 83  Archaeoglobus f...
WP_010885373   5 EKVEELHERKKKILQMGGEEAIKKQHEKGKLTARERLELLLDPGSFVEIGMFVKHRATEFGMDKRELPADGVITGYGTIN 84  Pyrococcus hori...
AAC36820      86 GRLVYAFAQDFTVEGGSLGEMHAAKIVKVQRLAMKMGAPIVGINDSGGARIQEAVDALAGYGKIFFENTNASGVIPQISV 165 Veillonella par...
CAA05137      81 GRVVYAFSQDFTVTGGALGEMHAKKICKAMDMAGKVGAPVVGLNDSGGARIQEAVDALSGYGDIFYRNSIYSGVVPQISA 160 Propionigenium ...
WP_010879706  84 GRPVAVFAQDFTVMGGSLGEMHGFKIAYILDFAMKLGIPVVGLNDSGGARIQEGVDALKGYGDIFYRNTLASGVIPQISV 163 Archaeoglobus f...
WP_010885373  85 GRLVFVYAQDFTVMGGSLGEMHAMKIKRIMELALEAGAPVIGLNDSGGARIQEGVDSLKGYGEIFKMNTILSGVVPQITA 164 Pyrococcus hori...
AAC36820     166 IMGPCAGGAVYSPALTDFIYMVKN-TSQMFITGPAVIKSVTGEEVTAEDLGGAMAHNSVSGVAHFAAENEDDCIAQIRYL 244 Veillonella par...
CAA05137     161 ILGPCAGGAVYSPALTDFIFMVDQ-TSQMFITGPQVIKTVTGEEVTAEQLGGAMTHNSTSGCAQFISQDDKACIDDIRRL 239 Propionigenium ...
WP_010879706 164 IMGPCAGGAVYSPAIGDFIVMTKNpNCYMFITGPQVIKTVTGEEVSAFDLGGWQAHAMKSGNCHLVAEDDRDAMMLVRRL 243 Archaeoglobus f...
WP_010885373 165 IMGPCAGGAVYSPAIGDFILMVDNpSTFMFITGPQVVKAVTGVEVTPVQLGGAMVHAQRSGQAHLIGKSDEEVIMLIKKL 244 Pyrococcus hori...
AAC36820     245 LGFLPSNNMEDAPLVDTGDDPTREDESLNSLLPDNSNMPYDMKDVIAATVD-----NGEYYEVQPFYATNIITCFARFDG 319 Veillonella par...
CAA05137     240 ISFLPSNNMEKAPEFGCEDDLNIQFPELDALMPDNPNKAYNMFDVITKIVD-----NGDYMEYQPHYSKNIITCFARVNG 314 Propionigenium ...
WP_010879706 244 LSYLPLNNMEDPPVVKTGDDPVRLTPEIYDVLPDDPQKPYDVRDVITAVVD-----NGELLEIHPYYAPNAVVGFARIDG 318 Archaeoglobus f...
WP_010885373 245 LSYLPSNNMEKPPRVKPKDEPFRRTPELYDIVPDDPNKGYDVRQVIYTIVDrdengNPDFLELQPYFAPNAVIGFGRING 324 Pyrococcus hori...
AAC36820     320 QSVGIIANQPKVMAGCLDINASDKSSRFIRFCDAFNIPIVNFVDVPGFLPGTNQEWGGIIRHGAKMLYAYSEATVPKITV 399 Veillonella par...
CAA05137     315 KSVGIIANQPQVMAGCLDIDSGDKCAKFIRTCDAFNIPLLTIVDVPGFLPGVTQEYGGIIRHGAKILYAYSEATVPKVTL 394 Propionigenium ...
WP_010879706 319 KSVGIVANNPRHFAGCLDVDSSDKIARFVRFCDAFNIPIITFVDVPGYLPGVQQEYGGIIRHGAKVLYAYSEATVPLVTI 398 Archaeoglobus f...
WP_010885373 325 QPVGIVANNPIHLAGVLDIDSSDKIARFVRFCDAFNIPIVTFVDVPGYLPGVDQESRGIIRHGAKVLYAYAEATVPMVTI 404 Pyrococcus hori...
AAC36820     400 ITRKAYGGSYLAMCSQDLGADQVYAWPTSEIAVMGPAGAANIIFKKD--EDKD------AKTAKYVEEFATPYKAAERGF 471 Veillonella par...
CAA05137     395 ITRKAYGGAYVAMCSKSLGADVVLAWPTAEIAVMGPAGAVNIIFRKDikDAKDpaattkQKLDEYTTEFANPYQAARRGL 474 Propionigenium ...
WP_010879706 399 ILRKAYGGAYLAMGSKHLGADIVYAYPTAEIAVMGPEGAAEIVFRKEikAAEDpkamreEKIREYREKFANPYRAAARGY 478 Archaeoglobus f...
WP_010885373 405 ILRKAYGGAYLAMGSKHLGADFVFAWPTAEIAVMGPEGAANIIFRKEiaKAENpeefrrQKIQEYREKFANPYVAAARGY 484 Pyrococcus hori...
AAC36820     472 VDVVIEPKQTRPAVINALAMLASKRENRAPKKHGNIPL 509 Veillonella parvula
CAA05137     475 VDDVIEPKTSRQRIVDAFNMLEGKREKLPAKKHGNIPL 512 Propionigenium modestum
WP_010879706 479 IDDIIDPKYTRVKVVSALRILESKREKLPPKKHGNIPL 516 Archaeoglobus fulgidus
WP_010885373 485 IDDVIDPAETRAKIVMALEALENKRVKLPPKKHGNIPL 522 Pyrococcus horikoshii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap