Conserved Protein Domain Family
mtrE

?
TIGR01113: mtrE 
N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit E
This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit E in methanogenic archaea. This methyltranfersae is membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of methyl-coenzyme M by another enzyme methyl-coenzyme M reductase. [Transport and binding proteins, Cations and iron carrying compounds, Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 130183
View PSSM: TIGR01113
Aligned: 5 rows
Threshold Bit Score: 397.686
Threshold Setting Gi: 2497846
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P80651   7 MGVLALIGVAATIAGASEDLESDIGSQSNPNSQVQLAPQMMFPHRIFNKAISGEPPSNALMCSIGAAIATVLIsEFTVSP 86  Methanosarcina mazei Go1
Q58257   8 LGALALSGALATVAGCAEDLESDVGSQSNPNSQVQLAPQMGNIHRYFNKAISGEPVSYGLYVAVAGTVAYAIM-QMGLNP 86  Methanocaldococcus ja...
Q49606   7 IGLAAAMGALATIAGAFEDAESDVGSQSNPNSQVQLAPQMMNFHRYFNKAISGEPVSYMLYGAIAGTVTWVMMtKFGLPF 86  Methanopyrus kandleri...
O27231   8 LGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSGEPVAYGTWCGIAGSVAYVLMqSMQLPV 87  Methanothermobacter t...
Q49176   8 LGILALTTASAIIGQTIEDVETNIGSQSNPNSQVQLAPQMGNLHRFFNKAIAGEPFAYCTFCGVSGAITVATL-YLHLPA 86  Methanothermus fervidus
P80651  87 LFALVFGSVIAASVHATFAVTATMGRCAS-QSRFKQPIYLDMIRSHTPAIMGYAFITTFCVLIVSYLMTVVLG---HPFP 162 Methanosarcina mazei Go1
Q58257  87 ILALILGAGVAAFVHGAYAISAYLGRIVGqSKNFGQPVYWDVVMSHLGPIVGHGFIAVFCMVLMAYLANTILG---NPFP 163 Methanocaldococcus ja...
Q49606  87 LAAAAVGVGVNALIHMVFATTAHLGRMAS-AAEFGHPIYLDVVLSHLGPIAGFGGIATFAIVSLAYIQWALLK---HPFP 162 Methanopyrus kandleri...
O27231  88 IMAIAVGAVIAAMVHTTYAVTSHMGRIVS-QSQFNQPLFMDMLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPgfaHPFP 166 Methanothermobacter t...
Q49176  87 VIALAIGAAITTLIWLAYSTTAYLGRVSG-SATFNQPVFLDMLTENLGPIAGHAFIVFFCMTGVAYLMTLPVKgfaHPFP 165 Methanothermus fervidus
P80651 163 LTMLAFIWGITIGAIGSSTGDVHYGAEREFQQFEFGSGLNASNSGNIVRYAESGLRNGFDNSWFCSKFGGPTTGIAFGMT 242 Methanosarcina mazei Go1
Q58257 164 LPLIALIFGITVGAIGSSTGDVHYGAEREYQKYPFGGGVPVANHGDIDIKAEYGLRNGMDSSYFCSRLGGVLTGLCFGLI 243 Methanocaldococcus ja...
Q49606 163 LPLLAALWGVTVGAIGSSTGDVHYGAERLYQHYPFGGGVPVAAHGNITRKAETGIRNSMDSVYFCAKFGNPLTGLCFGLV 242 Methanopyrus kandleri...
O27231 167 LPLLAVLWGITIGAIGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTGFAFGAI 246 Methanothermobacter t...
Q49176 166 IPVIGMIWGMTIGAIGSAVGDVYYGAEAEFVHKKFGGGIPVASHGDITRKGVLGARSPMEVGNFTVKYGSPITGMAFGLI 245 Methanothermus fervidus
P80651 243 VFLGSWITTIFDp----AQGLSMGwl--svIAGVIIVLILIIWNWKIEVQARKAYGPY 294 Methanosarcina mazei Go1
Q58257 244 VFLDGWRGVLGDilkggQGGSVITasiisiVIGLIIVAILAIINRKVEVFARNKYGPY 301 Methanocaldococcus jannaschii DSM 2661
Q49606 243 VFFSTWAGLFG------QWGAVI-------AMGLVTLGCLIVSNR-VEKKARESYGTY 286 Methanopyrus kandleri AV19
O27231 247 VFLSFWNTIVFG-----ITGGIIS--------GLIIVLLLIILNNRLEVFARNRYGPY 291 Methanothermobacter thermautotrophicus str....
Q49176 246 VLS--ITR-----------G---------------------VYN--IE---------- 257 Methanothermus fervidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap