Conserved Protein Domain Family
mtrA

?
TIGR01111: mtrA 
N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit A
This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit A in methanogenic archaea. This methyltranferase is a membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase (encoded by subunit A) is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of methyl-coenzyme M by another enzyme, methyl-coenzyme M reductase. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130181
View PSSM: TIGR01111
Aligned: 5 rows
Threshold Bit Score: 360.667
Threshold Setting Gi: 2330614
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58261         1 MANKREPAPGWPIVSGEYVVGNPESCVGVVTLGSHGLEQACIDAG---AAIAGPCHTENLGIEKVVANYISNPNIRFMIL 77  Methanocaldococ...
CAA74771       1 MPEKAEPAEGWPVVEGDYVVGDPEAPVHVVTLGSHIEEDILKAAGedkVAIAGPCKTENIGIEKVIANVIANPNIRFGVL 80  Methanopyrus ka...
CAB41642       1 MADKKEPAPGWPILKGEYEVGDVKNCVLVITCGSHLPGQPILDAG---AAVTGSCKTENLGIEKVVAHIISNPNIRYLLV 77  Methanosarcina ...
O59640         1 MADKREPAPGWPILKGEYEVGDVKNSVLVITCGSHLPGKPILDAG---AACTGSCKTENLGIEKVVAHIISNPNIRYLLV 77  Methanosarcina ...
WP_013296332   1 MVEKKSPAEGWPVVNGDYIVGDPESPVAATTLASHIED-IPVEAG---AAIAGPCKTENLGIEKMIANLISNPNIRFLIL 76  Methanothermoba...
Q58261        78 CGSEVQGHITGQCFKALWENGIG-DDGGIIGAKGAIPFLENVNKEAVERFRRQIvEVVDLIDCEDIGKITQAIKECLSKD 156 Methanocaldococ...
CAA74771      81 CGAEVTGHLTGQCFKAMYENGVDpDSGEIIGAEGAIPYLENIPEEAVERYRDQIvELVDLIDVEDVDEIVKAIEECVEKD 160 Methanopyrus ka...
CAB41642      78 TGSEVKGHITGQSVMSLHANGVK--DNRISGALGAIPYVENLNEDAIARFQEQV-DVVNLLDTEDMGAITSKVKELASKD 154 Methanosarcina ...
O59640        78 TGSEVKGHITGQSMMSLHANGVK--ENRIAGALGAIPYVENLNAAAVARFQEQV-QVVNLLDTEDMGAITSKVRELASKD 154 Methanosarcina ...
WP_013296332  77 CGSEVQGHITGQSIEALHQNGVDpDKRNIIGATGAIPYIENIPDEGIERFQKQL-EIVNLIDVEDADAIKAKVKECIEKD 155 Methanothermoba...
Q58261       157 PGAIDEDPFIIELEggKGgGEEEEGVIK--PITPEMAIIESRMRLIGNEMCYNGLLAKWQAGYYNGKIQGIATGLFLMLL 234 Methanocaldococ...
CAA74771     161 PGAYEEGPMTISLE--EE-EEEELAEVAgmPVSAETVTVEYRINDVRVGVKSIGAMQRYMAGYLSGRTMGLLIGIISGMI 237 Methanopyrus ka...
CAB41642     155 PGAFDAEPMIVEISe-EGeEEEEGGAVR--PVSGEIAVIRSRLKAIEARMMDIGNLNKFHSGVHAGKIEGAMIGLTVTIS 231 Methanosarcina ...
O59640       155 PGAFDADPLVVEISe-EGeEEEEGGVVR--PVSGEIAVLRSRLKAIEARMMDIGNLNKFHSGVHAGKVEGAMIGLTITIS 231 Methanosarcina ...
WP_013296332 156 PGAFEEEAMIIKVE--EGgEEEEGEEVK--PVAPETALIEARMRNIQTQVKMIGSTNRMFAGMYSGKVQGIMIGLAFTLT 231 Methanothermoba...
Q58261       235 IMGILM 240 Methanocaldococcus jannaschii DSM 2661
CAA74771     238 FLFLPM 243 Methanopyrus kandleri
CAB41642     232 LLGLLL 237 Methanosarcina barkeri
O59640       232 LLGLLL 237 Methanosarcina mazei Go1
WP_013296332 232 LGILLL 237 Methanothermobacter marburgensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap