Conserved Protein Domain Family
Na_pump_decarbB

?
TIGR01109: Na_pump_decarbB 
sodium ion-translocating decarboxylase, beta subunit
This model describes the beta subunits of sodium pump decarboxylases that include oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, and glutaconyl-CoA decarboxylase. Beta and gammma-subunits are integral membrane proteins, while alpha is membrane bound. Catalytically, the energy released by the decarboxylation reaction is coupled to the extrusion of Na+ ions across the membrane. [Transport and binding proteins, Cations and iron carrying compounds, Energy metabolism, Other]
Statistics
?
PSSM-Id: 130179
View PSSM: TIGR01109
Aligned: 6 rows
Threshold Bit Score: 319.42
Threshold Setting Gi: 118354
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF14627  19 G--QVIMIIVSLILLWLAIARRFEPLLLLPIGFGGLLSNIPEAglAMTALDhllhyahteqltiiaekvnsssldvhtik 96  Haemophilus ducreyi
AAB89172   3 G--SLVMIGVGLLLVYLGIVKKMEPLLLVPIGIGAILVNIPGG--GLAEEG----------------------------- 49  Archaeoglobus fulgi...
AAD35961  32 G--NIAMFAVAIALLYVAIVKHSEPLLLIPIAFGIILANIPVEttGILNEG----------------------------- 80  Thermotoga maritima...
AAC65052 109 GyqQALLLVVGLLIIYLGAAKGFEPLLLIPIGFGTVFVNIPGA--GMYSEH----------------------------- 157 Treponema pallidum ...
Q03031    19 G--QAIMLLVSLLLLWLAIAKKFEPLLLLPIGFGGLLSNIPEAglALTALEsllahhdagqlaviaaklhcapdvhai-k 95  Salmonella enterica...
P13156    19 G--QAIMLLVSLLLLWLAIAKKFEPLLLLPIGFGGLLSNIPEAglALTALEsllahrdpaqlaviaaklhcapdvhai-k 95  Klebsiella pneumoniae
AAF14627  97 qaiafappsvqneleviasdlgynaGILALFYKVAIGYGVAPLIIFMGVGAMTDFGPLLANPRTLLLGAAAQFGIFTTVL 176 Haemophilus ducreyi
AAB89172  50 -------------------------SIFDLFLKYLIHTEIVPLLIFLGLGALTDFSPLLANPKTFLLGAAAQIGIFAALI 104 Archaeoglobus fulgi...
AAD35961  81 --------------------------GFLYYIKKGLDLGIYPPLIFLGIGALTDFSFMLSYPITIFLGAAAQMGIFFTFF 134 Thermotoga maritima...
AAC65052 158 -------------------------GMLKLIYDAGVGNEFFPMLIFMGIGALTDFGPLIANPKMAVLGAAAQLGVFLTLF 212 Treponema pallidum ...
Q03031    96 ealalalpsvqnqmenlavdmgytpGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTLLLGAAAQFGIFATVL 175 Salmonella enterica...
P13156    96 aalalalpsvqgqmeslavdmgysaGVLAIFYKVAIGSGIAPLVIFMGVGAMTDFGPLLANPRTLLLGAAAQFGIFATVL 175 Klebsiella pneumoniae
AAF14627 177 GALGLNWLGiidfslPQAAAIGIIGGADGPTAIYLASKLAPELLGAIAVAAYSYMALVPLIQPPIMKALTTEQERKIRMV 256 Haemophilus ducreyi
AAB89172 105 AALFLGFTP------QEAASIGIIGGADGPTTIYTTTILAPHLLAATAVAAYSYMSLVPIIQPPIIKALTSSRERKIKMR 178 Archaeoglobus fulgi...
AAD35961 135 VAKVLGFSL------KQAASIAIIGGADGPTAIYITNTLSPELIAPIAISAYSYIALIPILQPVVSRILVSKEERKIRMK 208 Thermotoga maritima...
AAC65052 213 GVAALNFVPgirysiLDACAIAIIGGADGPTSIYVSAKLAPELMAVIAVAAYSYMALVPIIQPPLMRLLTTRKERLIRMK 292 Treponema pallidum ...
Q03031   176 GALTLNYFGlisftlPQAAAIGIIGGADGPTAIYLSGKLAPELLGAIAVAAYSYMALVPLIQPPIMKALTSETERKIRMV 255 Salmonella enterica...
P13156   176 GALTLNYFGiisftlPQAAAIGIIGGADGPTAIYLSGKLAPELLGAIAVAAYSYMALVPLIQPPIMKALTTDKERKIRMV 255 Klebsiella pneumoniae
AAF14627 257 QLRTVSAREKIVFPIVLLLLVALLLPDAAPLLGMFCFGNLMRASGVVERLNETAQNALINIVTIFLGLSVGAKLVADKFL 336 Haemophilus ducreyi
AAB89172 179 QLRIVSKKEKILFPIATIIISGFLAPKALPLVGMLMTGNLFRESGVTDRLAKGASEELMNIMTIILGLSVGSTMRAESFL 258 Archaeoglobus fulgi...
AAD35961 209 PPRKVSRFERLSFPIVITIVTALLIPKSLPLVGSLMFGNLLREAGIVKRLVEAASRYILDTVTILLMLSVGASARADVFL 288 Thermotoga maritima...
AAC65052 293 QLRPVSRIERVLFPLVLLLLSVLLIPAASPLIGMIAFGNFVKECGVVERLSKTMANELLNIVSILLSLGVGSQMTPDKIM 372 Treponema pallidum ...
Q03031   256 QLRTVSKREKILFPVVLLMLVALLLPDAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKFL 335 Salmonella enterica...
P13156   256 QLRTVSKREKILFPAVLLLLVALLLPDAAPLLGMFCFGNLMRESGVVERLSDTVQNALIQTHP--------MKKFSRRFC 327 Klebsiella pneumoniae
AAF14627 337 QPQTLGILLLGIVAFAIGTASGVIMAKIMNAFSKHKINPLIGSAGVSAVPMAARVSNKIGLEADKQNFLLMHAMGPNVAG 416 Haemophilus ducreyi
AAB89172 259 TQKTLLVLALGVVAFAAATAGGVLLAKVMNLFLKEKINPMIGAAGVSAVPMSARVVQRLAIEEDPHNHILMHAMGPNVAG 338 Archaeoglobus fulgi...
AAD35961 289 TPQSLMIFFLGAAAFIVSMSSGILFAKLMNLFLKDKINPLIGAAGVSAVPDSARVAQKLAQEEDPRNHILMHAMGPNVAG 368 Thermotoga maritima...
AAC65052 373 NPNALGIIVLGLVAFSVATAGGVFMAKLMNLFLSEKINPLIGSAGVSAVPMAARVSNKVGLEEDPSNFLLMHAMGPNVAG 452 Treponema pallidum ...
Q03031   336 QPQTLGILLLGVIAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSNKVGLESDAQNFLLMHAMGPNVAG 415 Salmonella enterica...
P13156       --------------------------------------------------------------------------------     Klebsiella pneumoniae
AAF14627 417 VISSAIAAGI 426 Haemophilus ducreyi
AAB89172 339 VIGSAVAAGV 348 Archaeoglobus fulgidus DSM 4304
AAD35961 369 VIGSATVAGV 378 Thermotoga maritima MSB8
AAC65052 453 VIGTAIAAGV 462 Treponema pallidum subsp. pallidum str. Nichols
Q03031   416 VIGSAIAAGV 425 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
P13156       ----------     Klebsiella pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap